SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000318965|PACid:22675342 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000318965|PACid:22675342
Domain Number 1 Region: 166-207
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00009
Family 2Fe-2S ferredoxin-related 0.029
Further Details:      
 
Weak hits

Sequence:  MDP0000318965|PACid:22675342
Domain Number - Region: 49-144
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0915
Family DNA repair protein MutS, domain III 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000318965|PACid:22675342
Sequence length 214
Sequence
MPKQNFFLMIDAWARRANPEEGEDKRVASEGKEEPQPKATESILSKRQRRQRVNSRRPFS
LIRLVSAFFSVYDFTNLFFSENIGLLRGLTIMFASQLSRIGFLILKQLSRGKSASLTRSG
YTSNSYRQCLQTLFDHQSETKLLRATIFENRYLFYTSSASHSSNEGIEQKEKISVTFVDK
DGEEKHIKVPTGMSILEAAHENDIELEGKVLMLI
Download sequence
Identical sequences MDP0000318965 MDP0000318965|PACid:22675342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]