SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000692555|PACid:22650354 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000692555|PACid:22650354
Domain Number 1 Region: 42-147
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.0000000000000683
Family 2Fe-2S ferredoxin-related 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000692555|PACid:22650354
Sequence length 155
Sequence
MAMASLQRLRHSQILHRLPSLSLISRSSASSTHSAKVSDRIVKLFAIDVDGRKXEVVGLS
GHTLLKALAQXGLIEPASHRLEDIDACSAECEVNIAQEWFDKLPPRSYDEEYVLKRNSRA
RVLNKHSRLGCQVVLTXELQGMVVAVPEAKPWDIP
Download sequence
Identical sequences MDP0000692555 MDP0000692555|PACid:22650354 XP_008348962.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]