SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000771887|PACid:22681314 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000771887|PACid:22681314
Domain Number 1 Region: 46-143
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.15e-33
Family 2Fe-2S ferredoxin-related 0.0000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000771887|PACid:22681314
Sequence length 147
Sequence
MAATAAAAVSSTMVSTSFIRGQPMTSLRLSPNVGQXLXGLKANRGGRVAMAAYKVKXITP
EGPQEFECPEDVYILDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQIG
GGFVLTCVAYPASDVTLETHKEEELTG
Download sequence
Identical sequences MDP0000771887|PACid:22681314 MDP0000771887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]