SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000776161|PACid:22665248 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000776161|PACid:22665248
Domain Number 1 Region: 72-178
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.18e-27
Family 2Fe-2S ferredoxin-related 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000776161|PACid:22665248
Sequence length 200
Sequence
MAXPSARVRVMDHXIPCNPCISLSIHRKPPLNRQIIWPNTVTHHSNITKWRRNTTSELQT
QVAVNDRTGDYSPSVPTHTVTVHDRQRGVSHQFLVPEDQYILHTAESQDITLPFACRHGC
CTSCAVRVKSGELRQPEALGISAELKSKGYALLCVGYPSSDLEVETQDEDEVYWLQFGRY
FARGPIDRDDYALELAMGDE
Download sequence
Identical sequences XP_008346491.1.92800 XP_008373563.1.92800 MDP0000776161 MDP0000802513 MDP0000776161|PACid:22665248 MDP0000802513|PACid:22644410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]