SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000789055|PACid:22625232 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000789055|PACid:22625232
Domain Number 1 Region: 314-660
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.05e-88
Family IF2B-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000789055|PACid:22625232
Sequence length 667
Sequence
MDPRRPPRAVSDPKVRQVGFFASPDPIASSSPPVSNSPSGNSLSPVMIPPPRHSSDTSRP
VLFPAVPASPARRESVLVESYNNSSELFPASPPTASSSYGIVMGNGEFLNDVVMSPGRTF
RRVRAAGGLTTSSSFPSGGFDLTAAVKASSVPASGLMTVSVLRHIVIAKLEETKIEAFAE
KDVDASTEVQGERAGNSKPLKEKTTKAERRALQEAQRAAKAAAKADGGKTPSVAASASAA
AIVKPPKATKLVSQSSMAVSEKKGGGGGGGSERPPEKERKKEVPHPRMQYDDKSRVEKAK
RRSVVKQTEARNRVELFRHLPQYEHGTQLPDLESKFFQLDPVHPAVYKVGLQYLSGDISG
GNARCIAMLLALQEAIKDYSTPPEKNLSRDLTAKISSYVSFFSECRPLSITMGNAIRFLK
SRIAKLPLTMSESEAKASLQSDIDRFIAEKIILADNVIVKHAVSKIRDGDVLLTYGSSSA
VEMLLLHAHELGKQFRVVVVDARPKLEGQRLLRRLVGKGLSCTYTHINAASYIMHEVTRV
FLGASSVLSNGTVYSRVGTACVAMVAHAFRVPVLVCCEAYKFHERVQLDSICSNELGDPD
VILKVPGREEVNPLDGHANCENLQPLNLIYDALPSDYISMIITDYGMVPPTSVPVIVREY
RREHSWM
Download sequence
Identical sequences MDP0000789055|PACid:22625232 MDP0000789055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]