SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000795736|PACid:22666879 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000795736|PACid:22666879
Domain Number 1 Region: 45-150
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.0000000000000242
Family 2Fe-2S ferredoxin-related 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000795736|PACid:22666879
Sequence length 158
Sequence
MAMASLQRLRHSQILHRLPSLSLISRSSASTSSPTHSAKVSDRIVKLFAIDVDGRKREVV
GLSGHTLLKALAQRGLIDPASHRLEDIDACSAECEVNIAQEWFDKLPPRSYDEEYVLKRN
SRARVLNKHSRLGCQVVLTPELQGMVVAVPEAKPWDIP
Download sequence
Identical sequences MDP0000129163|PACid:22668898 MDP0000795736|PACid:22666879 MDP0000129163 MDP0000795736 XP_008346778.1.92800 XP_008364639.2.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]