SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000868782|PACid:22651900 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000868782|PACid:22651900
Domain Number 1 Region: 47-187
Classification Level Classification E-value
Superfamily POZ domain 7.85e-18
Family BTB/POZ domain 0.022
Further Details:      
 
Domain Number 2 Region: 268-372
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-16
Family Ankyrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000868782|PACid:22651900
Sequence length 586
Sequence
MAHSAEPSSSLSFTSSPHLSNGSISHNLSCSGSESVPSLEVISLSKLSSSLEQLLIDPGC
DYSDADIVVEGIPVGVHRCILASRSGFFRELFKREKGSSGKEDRPKYCMSDFLPYGDVGY
EAFLVFLSYVYTGKLKPSPVEVSTCVHNVCAHDACRPAINFVVELMYAASIFQMPDLVSI
FERRLLNFVGKALSDNVVPILLVAFHCQLNQLIDQCVDRVARSDIDDISLEKGLPDEVVK
KIKSLRRNYQQDSDPNLPPADPLHEKRIRRIHKALDSDDVELVKLLLTESNITLDEANAL
HYAAAYCDPKVVTEVLALGLADVNLRNSRGYTVLHIAVMRKEPSIIVLLLTKGARASELT
SDGQSAVSICRRLTRPKDYHSKTEQGQEANKDRICIDVLEREMRRNPMAGDASISSQIMP
DDLHMELLNLENRVALARLFFPAEAKLAMVIAHAETSEFAAPSSSKGSSGNLMEVDLNET
PTVQNKRLHSRLEALMKTVRLGRCYFPHCSEVLDKFIDDDLPHLFYLEPGSSDEQKVKRR
RFMELKEEVQKAFDKDKAECNLSGLSSSSSTTSPEKIGANQKVREP
Download sequence
Identical sequences A0A191XY08
MDP0000868782 MDP0000868782|PACid:22651900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]