SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000937952|PACid:22639360 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000937952|PACid:22639360
Domain Number 1 Region: 254-646
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.05e-97
Family Regulator of chromosome condensation RCC1 0.00098
Further Details:      
 
Domain Number 2 Region: 14-128
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-21
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Domain Number 3 Region: 645-720
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.53e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0017
Further Details:      
 
Weak hits

Sequence:  MDP0000937952|PACid:22639360
Domain Number - Region: 852-919
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0785
Family Seryl-tRNA synthetase (SerRS) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000937952|PACid:22639360
Sequence length 1038
Sequence
MASPQRSGPVERDIDQAITALKKGATLLKYGRRGKPKFCPFRLSNDEALLIWYSGKEEKH
LKLCHVSTIIPGQRTAIFQRYPRPEKEYQSFSLLYNDRSLDLLPPPAGQICKDKDEAEVW
FVGLKAIITRGNYRNWRSESRLEGTSIDSPHARTRRHSPTVTPFCIGDPRDTEGVSLENI
PQSRLGRAFADIISYTATPKNAIQAESVSNASLSPVSVDNSNGRNSASEAFRVSLSSAVS
SSSQGSCQDDFDTLGDVFIWGEGIGGGVLGGGVDRVGSSYGSRTDALLPKVLESTVVVDV
HGIACGARHAVLVTKQGEIFSWGEESGGRLGHGVDTDVSHPKLIETLSGMNVELVACGEY
HTCAVTLSGDLYTWGDGTHHFGLLGHGSEVSHWIPKKVCGHLEGIHISYIACGPWHTAAV
TSGGQLFTFGDGTFGALGHGDHSSTSTPREVETLRGLRTTRIACGIWHTAAVVEVVNESS
SPETSSNSSYGKLYTWGDGDKGRLGHGDEQSKLVPARVAALVDKNICQVACGHNLTVGLT
TSGQVYTMGSAAYGQLGNPSADGKVPTLVEGEISFVEEIACGSYHVAVLTSKTEVYTWGR
GSNGQLGHGDNDHRYTPTPVDCMKDKQVKSVACGPNLTAAICLHKWVSSADHSVCSDCHN
PFGFRRKRHNCYNCGLVFCKACSSKKSLXAALAPNTNKPYRVCDECYSKLKKAAEASSAL
RSPIRSGNMRPKSHEVTDKENLIPMLRATLSRLSSFGTNNQGESKQLKQERKPEVRDNRV
FPDLNGQLQLGGFNLTRASTPPTAGSEKVVSPSIPASKKASRYTSPVSGKSSPRRSSEEI
ILEDSKHINGSLSQEIIQLRTQVEGLTLKSQHLEAELQRTSKKLKEVSAIAADEAEKRKS
AKEVIKSLTAQLKEMSERMPEGQMSHCNTGSISHAISFGNQLSKEPSLSNINTSQTLSNG
NSMDRILTNGTKSPTGKSERVLQDEPGVYITLSSLPDGSNELRRVRFSRRHFTEEAAERW
WAENGVKLCERHNIKGAE
Download sequence
Identical sequences MDP0000937952|PACid:22639360 MDP0000937952 XP_008389490.1.92800 XP_008389491.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]