SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Chlre4|182463|estExt_fgenesh2_kg.C_60058 from Chlamydomonas reinhardtii 4.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Chlre4|182463|estExt_fgenesh2_kg.C_60058
Domain Number 1 Region: 75-136
Classification Level Classification E-value
Superfamily Rubredoxin-like 2.02e-18
Family Rubredoxin 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Chlre4|182463|estExt_fgenesh2_kg.C_60058
Sequence length 169
Sequence
MALLAPTTRCLSRPASSSRAAVAVPRLPIRARNVRVFSSTETDPELMGEAERKKLEAEKL
RAAEKFMVIGSGSATCKGCGYEYKPEKGDPEFPVAPGTTYQSLPEDYTCPICGAPKTKFE
SRVKVVAGFAENQQYGLGGNSMTEAQKSGLIYGALALFFALFLAGYALE
Download sequence
Identical sequences A8I686
3055.JGI182463 jgi|Chlre4|182463|estExt_fgenesh2_kg.C_60058 XP_001700979.1.80978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]