SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Chlre4|327366|pg.chromosome_6_#_746 from Chlamydomonas reinhardtii 4.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Chlre4|327366|pg.chromosome_6_#_746
Domain Number 1 Region: 788-1043
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000203
Family Tropomyosin 0.00076
Further Details:      
 
Domain Number 2 Region: 640-819
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000647
Family Tropomyosin 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Chlre4|327366|pg.chromosome_6_#_746
Sequence length 1507
Sequence
MWGQLNNLTKLVTEQAGSVIEKAGLDATALNTAKQQLTGQLGKIAESVLVIEPGKTPDAT
RHGGESSLPLSTTGSATEGTALGQLQGENASLQRRLAALEEAASDALGELEDAKEELGRE
RAARSAAESRLEAVQEELERVLAEQRSSSGSGAGAGGTASGDVADEVAKLKEALEAAQAH
GKAMETKGRKQYSLLMSTKQQLTELQAAHDQLAARNEELAAEVEQLREAAAAAEERLAEQ
AEVDRSLRAAAKGLQAQVAELSSRAAHSDVAGDDGSAAQHGALLAAEVAELRQQLETADA
RIAALEADLAAAEATAEAAKAGAIGQVDAGEQLEQLRGELAAANAAVQQAESAATKAAAE
VARLTAELEQQQQRHQEQQAEQASARMGELWSQLSTATKQADALQAEAAALRSELAEARQ
ALEERSAAAVAAARRAEAVQAAQVAQAAQAAAAQAALKEDAERAAEARDAEEARHRRQVE
ELSESIEELQKQLSTKSRAADDSAALAHRLMASVGQLHTAFTVYESVRAAPAAATAAAAS
PFDQLLDELDRLREQQAADVGAGTEGAADADGGCASPEPVSPPSSSSAQKKGGKQGGSGG
GAPAPVSAGRRRSSSNGVAAPDAAELAALQQELSRLRSELAAARVAGDAAAQLRGQLTAR
EQELFEARQRLQAAEAERCGAEERAHKLQAQLREAREAGDTVSAEAGERRRRVEALETSL
AAAEARATKLEEAAAAAAAEAAEAAKALEARLQAAEAAAKRAEEALEEARAAGAASSAAA
AAGSEAAALAAALEADKSRLEAEAQRLAAEVDQLQQAVDRGAEALAAAHKAAAAAEAGRE
EAVATATALEARVAELTSQLSELGKRLEGGGEASKAHAAALAAANKSATELQSRVTELEA
ALATKSTALQASERSLASVKAELRDMRTELEASQKAAADARAQGDKLEKELAHKTSALDA
VRTGSQAEVAVAAQRLTAISARVSELEAALAAATSSHQEALTALQHKLTAMEKEAVAART
SARQLEQQVAVLRDSLTAERDAAAATAAVVKSECEAKMAAELASASAAAVKQWQARLEEA
AQRHATALQETQAELEALRTRATAAEEELAGLKAASGDMDRLRQKVADFGPLISRLESDK
AAAKAAATEAVAAKDALEERVRTMEAEAAERNRKFQMLQRSFKGDAEATKTQLEAVRAQI
ASHVAAAAAAEQRADEAAARAEAAEAEREALAQQLLDAKAAAARLEAALAAQMAAAAEAA
AKLASAEAVLAEERAGRAAAASNGESLQHDFDRLVAAAVAAREEEAERQVAAALQREQAA
LAEARAAEARAEAAEVAKIELTLALARVDESGPSGLGAMASFGRGASVSVPNEMSSSSGG
AAGEGGMAGLGSAAAAAQERRIARQAELLDDMQRRLEEAELAAAVQTRRAVSAEGDLALM
KEQLADAQRQVKELSWQIKVAFGGGGAATIGGKQGGPGGAGGAGGGGGGGAMGMLDILGC
GANYRRN
Download sequence
Identical sequences A0A2K3DR43
jgi|Chlre4|327366|pg.chromosome_6_#_746 3055.JGI327366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]