SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Chlre4|344092|estExt_fgenesh1_pg.C_chromosome_60078 from Chlamydomonas reinhardtii 4.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Chlre4|344092|estExt_fgenesh1_pg.C_chromosome_60078
Domain Number 1 Region: 422-599
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000305
Family Tropomyosin 0.0038
Further Details:      
 
Domain Number 2 Region: 590-776
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000817
Family Tropomyosin 0.0083
Further Details:      
 
Weak hits

Sequence:  jgi|Chlre4|344092|estExt_fgenesh1_pg.C_chromosome_60078
Domain Number - Region: 310-414
Classification Level Classification E-value
Superfamily Tropomyosin 0.0135
Family Tropomyosin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Chlre4|344092|estExt_fgenesh1_pg.C_chromosome_60078
Sequence length 917
Sequence
MLACSTQHPASRLRCPKGTRRAVVVSAGPNQATARNSVVTRRATVLGGLATLFLGLPRNS
VASPVEAPEATTASPPSNAPVKDVKQPAGPSSGSSGAPLGTIGAIAASGVAAFFGLQLNQ
QKQEAATAQSKVAGAEAARDKLNAQVATLTAQLGAEQEAARAAAGKARKEVAAKDEELSR
RQADLSRATQEARAAESRANAAAAQLAAAEGKLRDARAELDVLSAAAKEAGDKAAAATTR
AQQLSMALAREKAEAEKALGEARAKAAAAVKAQAAAEEAGMRARTELGKARSRATRLESE
LAERTAALSALEASAAAAAAQAEALREQLGAADGRLASANSRVAGLEAEAAAARAERGRL
AEALAAEERRVKEQQAAAEAAARDTAALMERAAALEEELSRTTELMHAAKADLHAESAAS
KALQAQVEALQDKVAAGATRLAAAEKAAAAADMRGTELSQQVTDLQSELEATLAKLQAAE
GARAAAAAAATDANDRAEDMGRQMDRLAEHLDKNEAELETERSTRHELRRELDELSEAHA
KLEATARALKGSQEAAARQLVDSQGQLREAESRADKQREKAQHYKQEAERAASELAALRT
ELDAARAASKAADSKVAELSGMLAGWEARGKELDTKVKAAENREAELVRVADTSKTALTK
LEQNATTIRREMAESEMRGVAMRQEVAELKEQLDSAKAELQAAKAASGAGSQQLQQQVTH
LQNELSAAQAAAAQAEELRQQVAARDRQVAELQRALKQAAAAANANGGAQGELEFNIPAA
AASASSGPAPAGSKGDAPKRARATTAKSASRPAPVMKAEPEAAPAAAAAPAAAAEAEAPK
PRRRATAKSAGRPAPVARMTVVEAAAAAAAAASAAPAAGAHVAAAAPAPSVEPKAPKRQR
RSTKTAKPAADSTQQQA
Download sequence
Identical sequences A0A2K3DMB8
3055.JGI344092 jgi|Chlre4|344092|estExt_fgenesh1_pg.C_chromosome_60078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]