SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333996496|ref|YP_004529108.1| from Treponema primitia ZAS-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333996496|ref|YP_004529108.1|
Domain Number 1 Region: 92-159,217-285
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.71e-33
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0021
Further Details:      
 
Domain Number 2 Region: 3-96
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.91e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.016
Further Details:      
 
Domain Number 3 Region: 139-218
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.77e-18
Family Short-chain ferredoxins 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333996496|ref|YP_004529108.1|
Sequence length 288
Comment nitrite/sulfite reductase, 4Fe-4S iron-sulfur cluster-binding domain-containing protein [Treponema primitia ZAS-2]
Sequence
MAEVDYATLKKGGFMRQIQTDQFSMRLKVIGGQLKAEHLQKISEVAKKYGKGYIHLTSRQ
GVEIPFISLKDIEEVKKELSSAGVSIGVCGPRVRTVTACQGSTICPSGAIETSALAEELD
TRYFGRELPHKFKIGITGCKNNCLKAEENDLGIKGGISPEWNKQDCTYCGVCEAVCPVNA
VKVDKDKSELSFTESACVYCGKCVKSCPSSAWQGKNGYFLSFGGMFGNEIKEGLHLLPLL
FDKEKVFKAVDATVKFYQNNGKGGERLGRTLIRVGSGGLKKEVEEAVQ
Download sequence
Identical sequences F5YLK3
WP_015706239.1.95728 gi|333996496|ref|YP_004529108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]