SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333997103|ref|YP_004529715.1| from Treponema primitia ZAS-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333997103|ref|YP_004529715.1|
Domain Number 1 Region: 53-254
Classification Level Classification E-value
Superfamily CNF1/YfiH-like putative cysteine hydrolases 1.61e-51
Family YfiH-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333997103|ref|YP_004529715.1|
Sequence length 256
Comment hypothetical protein TREPR_3442 [Treponema primitia ZAS-2]
Sequence
MTAKLYPFTLNFDTSPNQARFPLMMEGEELGEISCALSSRSAGDMVYSEEGNPNRDRFFS
ALGLDPEKVKSCTQVHSRDVIVADRRSAGFPEADGMVSRDREIALSVTVADCLPVYLYDT
GTGAFALVHSGWKGTGIALSALSLMTERWWTRPEDVAALLGPCIRSCCYQVDEERAAAFE
AEFGGPDGDYPLGPVVLRNGDKPSLDLQAANARLLANAGVRNIAYCENCTFTDQRLGSFR
REGNAYTRMSGVMGFF
Download sequence
Identical sequences F5YJH8
WP_015706846.1.95728 gi|333997103|ref|YP_004529715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]