SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|90023074|ref|YP_528901.1| from Saccharophagus degradans 2-40

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90023074|ref|YP_528901.1|
Domain Number 1 Region: 434-570
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.54e-31
Family Flavohemoglobin, C-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 330-431
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.23e-22
Family Ferredoxin reductase FAD-binding domain-like 0.0005
Further Details:      
 
Domain Number 3 Region: 563-665
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.44e-17
Family 2Fe-2S ferredoxin-related 0.022
Further Details:      
 
Domain Number 4 Region: 190-281
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.00000000869
Family PNP-oxidase like 0.019
Further Details:      
 
Weak hits

Sequence:  gi|90023074|ref|YP_528901.1|
Domain Number - Region: 37-129
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.0813
Family PNP-oxidase like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|90023074|ref|YP_528901.1|
Sequence length 674
Comment pyridoxamine 5'-phosphate oxidase-related, FMN-binding [Saccharophagus degradans 2-40]
Sequence
MKRLQPSQFHQAEKAVQKRLGVADMVAQHSEGYIRSTMPGQHRDFFTNLPMVIVSITDFD
GFPWPIPLHGKPGFIKSPNANTLEIETYPTLKDVLKLNFKKSQKIGILGIELHTRRRNRM
NGTIKEINNNSFLVICEQSFGNCPQYIQKRELHWVDTPQKCLQTEDIFLTNTLTSTCAEW
IESSDTFFISSRTKRLSTDKRDGLDVSHRGGKPGFVKVENDTLYFPDFSGNQFFNTLGNI
QSDSRVGLYFPDYESGKIILISGTAKIIWDKELTRIFEGAERIISVKVRNCLILDSFLPM
RGVLTELSPSLIRTGTWENPQEKSAARVYKQFKIIKKIKESRDVTSFYIRPLDGSALSSY
LPGQFLPISIKQPHTSSTCLRTYTLSQAPLSNAYRFSVKREKFGLASRILHDTINTGDSL
YVSQPEGKFTLQTNKKTNVLLSAGIGITPMIAMLQGLIREVEKGEKPQDVYFIHSTQNSE
THTFANELKHLNKRHKWLQLYTIYSQPKLNDKLGQHYDVSGRISLDLLRKILPTDNFDVY
LCGSESFMRSSYTNLKAMGIAESRIFYEFFDDGSFESHQLNKFQTAQRAEIYFAKSNITA
TWTPNDGTLLQFAEKMGLKPMYSCRTGNCGTCSCTLSTGEVTYANKPGYTPANGSALICC
ARPALNTTKLTFHI
Download sequence
Identical sequences Q21F40
WP_011469905.1.82451 gi|90023074|ref|YP_528901.1| 203122.Sde_3434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]