SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|82778407|ref|YP_404756.1| from Shigella dysenteriae Sd197

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82778407|ref|YP_404756.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.52e-108
Family FMN-linked oxidoreductases 0.0000000000112
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.71e-42
Family N-terminal domain of adrenodoxin reductase-like 0.000000341
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.29e-26
Family C-terminal domain of adrenodoxin reductase-like 0.0000000713
Further Details:      
 
Weak hits

Sequence:  gi|82778407|ref|YP_404756.1|
Domain Number - Region: 610-665
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0142
Family C-terminal domain of adrenodoxin reductase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82778407|ref|YP_404756.1|
Sequence length 672
Comment NADPH dehydrogenase [Shigella dysenteriae Sd197]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFDHCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYHNRMRFAVEVVSAVRERVGNDFIIIYRLSMLDLVEDGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYRRMIEVTGVTLKLNHTVTANQLQEFDETILASGIVPRTPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIAGFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPSVSYQKI
DDDGLHMVINGETQIIAVDHVVICAGQEPNRTLAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A090NGU3 E2X7L7 Q32BP0
gi|560159078|ref|YP_008851793.1| gi|82778407|ref|YP_404756.1| WP_000121488.1.35349 WP_000121488.1.50304 YP_404756.1.10455 300267.SDY_3265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]