SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|82779014|ref|YP_405364.1| from Shigella dysenteriae Sd197

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82779014|ref|YP_405364.1|
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 4.92e-62
Family Frataxin-like 0.0000562
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82779014|ref|YP_405364.1|
Sequence length 106
Comment frataxin-like protein [Shigella dysenteriae Sd197]
Sequence
MNDSEFHRLADQLWLTIEERLDDWDGDSDIDCEINGGVLTITFENGSKIIINRQEPLHQV
WLATKQGGYHFDLKGDEWICDRSGETFWDLLEQAATQQAGETVSFR
Download sequence
Identical sequences A0A023Z5F6 A0A024KK80 A0A025C0Q6 A0A026UZN9 A0A027TGL2 A0A027ZKV4 A0A028E2D2 A0A064T0M1 A0A069XI80 A0A070FJX7 A0A070T033 A0A070UYL1 A0A073FP90 A0A073HDX3 A0A073UHZ3 A0A074HKW5 A0A080FI54 A0A090NDA0 A0A0A0FBL3 A0A0A8UL30 A0A0E0U6W8 A0A0E0Y5V8 A0A0E1M3V9 A0A0E1T367 A0A0I1KEJ7 A0A0K9T784 A0A0M7PBZ2 A0A192CEJ8 A0A1S6TIV4 A0A1S9JD04 A0A1S9KIG5 A0A1X3HZT4 A0A1X3IEF2 A0A1X3JAM2 A0A1X3KW50 A0A1X3LAP0 A0A1X3LPY3 A0A222QTC3 A0A2A2XQU4 A0A2H1BJ56 A7ZU09 B1IW97 B1XAH3 B3X3X2 B6I4E2 B7L963 B7M605 B7NFA9 C3SKF0 C4ZZ71 C8TYQ2 C8UJI6 D3QX98 D6I359 D6IG39 D6JHC1 D7XDB9 D7XMA8 D7YBS4 D7ZK18 D8E9L5 E1ITG3 E1J5W7 E2X512 E3PNZ4 E6BNM7 E7T4S9 E9TMW3 E9XUI5 E9Z195 F3VD23 F4NQF5 F4SRL2 F4TMG4 F4V8C8 F4VLC9 G0F7G4 H4URI8 I0VX59 I2RCY0 I2RVY4 I2SQ06 I2UCR3 I2WCJ3 I2X1Q5 I2X448 I4S2C6 I6CYE9 J7QT83 K4XDY0 K4XKF9 L2VDU1 L2X5A0 L3BZ53 L3NS65 L3PVX7 L3QAA4 L4UYC2 M9GUF1 P27838 Q329Y2 Q3YVG0 S0VKL7 S1D2H1 S1GEW5 S1IUI5 S1NV79 T5U007 T5ZL39 T8KDF7 T9C5K5 U9Y561 U9YTN2 U9YY71 U9ZPX2 V0YJB6 V2S0S4 V2T0N6 V6FQU4 V8FFJ7 V8KB85 W1F3B2 W1WHB3 W8ZYT2
gi|386616616|ref|YP_006136282.1| gi|383181052|ref|YP_005459057.1| gi|407466810|ref|YP_006786748.1| gi|560159882|ref|YP_008852597.1| gi|556553653|ref|YP_008724163.1| gi|157155891|ref|YP_001465288.1| gi|407484465|ref|YP_006781615.1| 1ew4A gi|260857790|ref|YP_003231681.1| gi|218556366|ref|YP_002389280.1| 1ew4_A 2eff_A 2p1x_A gi|209921279|ref|YP_002295363.1| gi|471335302|ref|YP_007558779.1| gi|170022170|ref|YP_001727124.1| gi|74314319|ref|YP_312737.1| 000006645|e1ew4A1|241.2.1.2|A:1-106 000076268|e2p1xA1|241.2.1.2|A:1-106 000076269|e2effA1|241.2.1.2|A:1-106 000076270|e1soyA1|241.2.1.2|A:3-108 cath|current|1ew4A00/1-106 cath|current|2effA00/1-106 cath|current|2p1xA00/1-106 d1ew4a_ d1soya_ d2effa_ d2p1xa_ gi|443619878|ref|YP_007383734.1| gi|386707072|ref|YP_006170919.1| gi|82779014|ref|YP_405364.1| gi|170083289|ref|YP_001732609.1| gi|260870529|ref|YP_003236931.1| gi|387623459|ref|YP_006131087.1| gi|291285220|ref|YP_003502038.1| gi|387509254|ref|YP_006161510.1| gi|16131659|ref|NP_418251.1| gi|238902884|ref|YP_002928680.1| gi|387614506|ref|YP_006117622.1| gi|388479443|ref|YP_491635.1| gi|410485011|ref|YP_006772557.1| gi|218697521|ref|YP_002405188.1| gi|386621479|ref|YP_006141059.1| NP_418251.1.90541 WP_000999947.1.100014 WP_000999947.1.100044 WP_000999947.1.100052 WP_000999947.1.100063 WP_000999947.1.100066 WP_000999947.1.100085 WP_000999947.1.100111 WP_000999947.1.100135 WP_000999947.1.100138 WP_000999947.1.100185 WP_000999947.1.100194 WP_000999947.1.100227 WP_000999947.1.100251 WP_000999947.1.100252 WP_000999947.1.100281 WP_000999947.1.100283 WP_000999947.1.100304 WP_000999947.1.100315 WP_000999947.1.10034 WP_000999947.1.100346 WP_000999947.1.100389 WP_000999947.1.100425 WP_000999947.1.100441 WP_000999947.1.100448 WP_000999947.1.100451 WP_000999947.1.100474 WP_000999947.1.10048 WP_000999947.1.100487 WP_000999947.1.100499 WP_000999947.1.10051 WP_000999947.1.100531 WP_000999947.1.100543 WP_000999947.1.100571 WP_000999947.1.100573 WP_000999947.1.100614 WP_000999947.1.100667 WP_000999947.1.10067 WP_000999947.1.10068 WP_000999947.1.100685 WP_000999947.1.100689 WP_000999947.1.100718 WP_000999947.1.100725 WP_000999947.1.100752 WP_000999947.1.100753 WP_000999947.1.100758 WP_000999947.1.100778 WP_000999947.1.100796 WP_000999947.1.10080 WP_000999947.1.100803 WP_000999947.1.100824 WP_000999947.1.100836 WP_000999947.1.100851 WP_000999947.1.100852 WP_000999947.1.10086 WP_000999947.1.100867 WP_000999947.1.100868 WP_000999947.1.100928 WP_000999947.1.100933 WP_000999947.1.100966 WP_000999947.1.100990 WP_000999947.1.10100 WP_000999947.1.101033 WP_000999947.1.101087 WP_000999947.1.101096 WP_000999947.1.1011 WP_000999947.1.101102 WP_000999947.1.101121 WP_000999947.1.101148 WP_000999947.1.101157 WP_000999947.1.101158 WP_000999947.1.101175 WP_000999947.1.101186 WP_000999947.1.101214 WP_000999947.1.101216 WP_000999947.1.101255 WP_000999947.1.101257 WP_000999947.1.10126 WP_000999947.1.101282 WP_000999947.1.101289 WP_000999947.1.101293 WP_000999947.1.101313 WP_000999947.1.101359 WP_000999947.1.101387 WP_000999947.1.101399 WP_000999947.1.101418 WP_000999947.1.101423 WP_000999947.1.101430 WP_000999947.1.101436 WP_000999947.1.101468 WP_000999947.1.101486 WP_000999947.1.10154 WP_000999947.1.101583 WP_000999947.1.101594 WP_000999947.1.101630 WP_000999947.1.101651 WP_000999947.1.101653 WP_000999947.1.101654 WP_000999947.1.101668 WP_000999947.1.101686 WP_000999947.1.10173 WP_000999947.1.101737 WP_000999947.1.101747 WP_000999947.1.101769 WP_000999947.1.101777 WP_000999947.1.101786 WP_000999947.1.10184 WP_000999947.1.101840 WP_000999947.1.101845 WP_000999947.1.101855 WP_000999947.1.101865 WP_000999947.1.10187 WP_000999947.1.10188 WP_000999947.1.101887 WP_000999947.1.101889 WP_000999947.1.10190 WP_000999947.1.101900 WP_000999947.1.101908 WP_000999947.1.101913 WP_000999947.1.101932 WP_000999947.1.101937 WP_000999947.1.101940 WP_000999947.1.101942 WP_000999947.1.101947 WP_000999947.1.101948 WP_000999947.1.101952 WP_000999947.1.101962 WP_000999947.1.101964 WP_000999947.1.102021 WP_000999947.1.102069 WP_000999947.1.102093 WP_000999947.1.102104 WP_000999947.1.102122 WP_000999947.1.10222 WP_000999947.1.10235 WP_000999947.1.10252 WP_000999947.1.10304 WP_000999947.1.10329 WP_000999947.1.10348 WP_000999947.1.10352 WP_000999947.1.10379 WP_000999947.1.10381 WP_000999947.1.1040 WP_000999947.1.10417 WP_000999947.1.10461 WP_000999947.1.10491 WP_000999947.1.10496 WP_000999947.1.10508 WP_000999947.1.10524 WP_000999947.1.10525 WP_000999947.1.10538 WP_000999947.1.10569 WP_000999947.1.10573 WP_000999947.1.10576 WP_000999947.1.10579 WP_000999947.1.10607 WP_000999947.1.10628 WP_000999947.1.10651 WP_000999947.1.10673 WP_000999947.1.10705 WP_000999947.1.1071 WP_000999947.1.10715 WP_000999947.1.10729 WP_000999947.1.1073 WP_000999947.1.1074 WP_000999947.1.10744 WP_000999947.1.10748 WP_000999947.1.10763 WP_000999947.1.10771 WP_000999947.1.10798 WP_000999947.1.10824 WP_000999947.1.10833 WP_000999947.1.10842 WP_000999947.1.10849 WP_000999947.1.10862 WP_000999947.1.10922 WP_000999947.1.10940 WP_000999947.1.10988 WP_000999947.1.10989 WP_000999947.1.10995 WP_000999947.1.11006 WP_000999947.1.11032 WP_000999947.1.11047 WP_000999947.1.11052 WP_000999947.1.11068 WP_000999947.1.11071 WP_000999947.1.11091 WP_000999947.1.11118 WP_000999947.1.11121 WP_000999947.1.1113 WP_000999947.1.11133 WP_000999947.1.112 WP_000999947.1.1122 WP_000999947.1.11241 WP_000999947.1.11251 WP_000999947.1.11272 WP_000999947.1.11315 WP_000999947.1.11323 WP_000999947.1.11408 WP_000999947.1.11436 WP_000999947.1.11437 WP_000999947.1.11440 WP_000999947.1.11452 WP_000999947.1.11499 WP_000999947.1.11524 WP_000999947.1.11542 WP_000999947.1.11578 WP_000999947.1.11595 WP_000999947.1.11607 WP_000999947.1.11612 WP_000999947.1.11616 WP_000999947.1.11645 WP_000999947.1.11673 WP_000999947.1.1168 WP_000999947.1.11699 WP_000999947.1.11748 WP_000999947.1.11759 WP_000999947.1.1176 WP_000999947.1.11762 WP_000999947.1.11801 WP_000999947.1.11803 WP_000999947.1.11844 WP_000999947.1.1186 WP_000999947.1.11949 WP_000999947.1.11955 WP_000999947.1.11956 WP_000999947.1.1196 WP_000999947.1.11981 WP_000999947.1.11982 WP_000999947.1.11985 WP_000999947.1.12000 WP_000999947.1.12030 WP_000999947.1.12036 WP_000999947.1.12050 WP_000999947.1.12051 WP_000999947.1.12095 WP_000999947.1.12112 WP_000999947.1.12115 WP_000999947.1.1212 WP_000999947.1.12151 WP_000999947.1.1218 WP_000999947.1.12204 WP_000999947.1.12279 WP_000999947.1.12292 WP_000999947.1.12319 WP_000999947.1.12320 WP_000999947.1.12344 WP_000999947.1.12352 WP_000999947.1.12415 WP_000999947.1.1242 WP_000999947.1.12426 WP_000999947.1.12458 WP_000999947.1.12478 WP_000999947.1.12542 WP_000999947.1.12558 WP_000999947.1.12566 WP_000999947.1.12574 WP_000999947.1.12582 WP_000999947.1.12623 WP_000999947.1.12645 WP_000999947.1.12646 WP_000999947.1.12680 WP_000999947.1.12693 WP_000999947.1.12697 WP_000999947.1.127 WP_000999947.1.12717 WP_000999947.1.12743 WP_000999947.1.12749 WP_000999947.1.1275 WP_000999947.1.12756 WP_000999947.1.12762 WP_000999947.1.12766 WP_000999947.1.12775 WP_000999947.1.12781 WP_000999947.1.1280 WP_000999947.1.12831 WP_000999947.1.12876 WP_000999947.1.12893 WP_000999947.1.12911 WP_000999947.1.12914 WP_000999947.1.12917 WP_000999947.1.12944 WP_000999947.1.1295 WP_000999947.1.12956 WP_000999947.1.12976 WP_000999947.1.12979 WP_000999947.1.12987 WP_000999947.1.12991 WP_000999947.1.13015 WP_000999947.1.13031 WP_000999947.1.13074 WP_000999947.1.1308 WP_000999947.1.13117 WP_000999947.1.1312 WP_000999947.1.13136 WP_000999947.1.1314 WP_000999947.1.1315 WP_000999947.1.13162 WP_000999947.1.13176 WP_000999947.1.13222 WP_000999947.1.13239 WP_000999947.1.13252 WP_000999947.1.13258 WP_000999947.1.13278 WP_000999947.1.13281 WP_000999947.1.13290 WP_000999947.1.13295 WP_000999947.1.13301 WP_000999947.1.13333 WP_000999947.1.13346 WP_000999947.1.1335 WP_000999947.1.13383 WP_000999947.1.13411 WP_000999947.1.13437 WP_000999947.1.1345 WP_000999947.1.13451 WP_000999947.1.13469 WP_000999947.1.13473 WP_000999947.1.13492 WP_000999947.1.13525 WP_000999947.1.13566 WP_000999947.1.13585 WP_000999947.1.13589 WP_000999947.1.13601 WP_000999947.1.13618 WP_000999947.1.13624 WP_000999947.1.13644 WP_000999947.1.13656 WP_000999947.1.13740 WP_000999947.1.13791 WP_000999947.1.13877 WP_000999947.1.13891 WP_000999947.1.13924 WP_000999947.1.13934 WP_000999947.1.13944 WP_000999947.1.13949 WP_000999947.1.13981 WP_000999947.1.14030 WP_000999947.1.14042 WP_000999947.1.14058 WP_000999947.1.14062 WP_000999947.1.14070 WP_000999947.1.14094 WP_000999947.1.14127 WP_000999947.1.14154 WP_000999947.1.14199 WP_000999947.1.142 WP_000999947.1.14277 WP_000999947.1.14292 WP_000999947.1.14299 WP_000999947.1.14304 WP_000999947.1.14346 WP_000999947.1.1438 WP_000999947.1.1439 WP_000999947.1.14398 WP_000999947.1.14417 WP_000999947.1.14432 WP_000999947.1.14451 WP_000999947.1.14493 WP_000999947.1.14499 WP_000999947.1.14501 WP_000999947.1.14506 WP_000999947.1.14508 WP_000999947.1.14529 WP_000999947.1.14536 WP_000999947.1.14581 WP_000999947.1.14582 WP_000999947.1.14600 WP_000999947.1.14601 WP_000999947.1.14607 WP_000999947.1.1461 WP_000999947.1.14616 WP_000999947.1.14648 WP_000999947.1.14672 WP_000999947.1.14678 WP_000999947.1.14687 WP_000999947.1.14693 WP_000999947.1.1470 WP_000999947.1.14711 WP_000999947.1.14746 WP_000999947.1.14749 WP_000999947.1.14811 WP_000999947.1.14833 WP_000999947.1.1486 WP_000999947.1.14861 WP_000999947.1.14871 WP_000999947.1.14879 WP_000999947.1.14956 WP_000999947.1.14958 WP_000999947.1.14965 WP_000999947.1.14977 WP_000999947.1.14992 WP_000999947.1.14993 WP_000999947.1.15007 WP_000999947.1.1508 WP_000999947.1.15087 WP_000999947.1.15090 WP_000999947.1.1510 WP_000999947.1.15117 WP_000999947.1.1512 WP_000999947.1.15121 WP_000999947.1.15138 WP_000999947.1.15148 WP_000999947.1.15191 WP_000999947.1.15193 WP_000999947.1.15207 WP_000999947.1.15221 WP_000999947.1.1524 WP_000999947.1.15245 WP_000999947.1.15252 WP_000999947.1.15259 WP_000999947.1.15270 WP_000999947.1.15277 WP_000999947.1.15287 WP_000999947.1.15290 WP_000999947.1.15300 WP_000999947.1.15332 WP_000999947.1.15335 WP_000999947.1.15347 WP_000999947.1.15377 WP_000999947.1.15416 WP_000999947.1.1543 WP_000999947.1.15444 WP_000999947.1.15453 WP_000999947.1.15464 WP_000999947.1.15469 WP_000999947.1.15496 WP_000999947.1.15521 WP_000999947.1.15528 WP_000999947.1.15538 WP_000999947.1.15565 WP_000999947.1.15576 WP_000999947.1.15593 WP_000999947.1.15600 WP_000999947.1.1561 WP_000999947.1.15620 WP_000999947.1.15624 WP_000999947.1.15645 WP_000999947.1.15654 WP_000999947.1.15707 WP_000999947.1.15740 WP_000999947.1.15752 WP_000999947.1.15762 WP_000999947.1.15767 WP_000999947.1.15771 WP_000999947.1.15791 WP_000999947.1.1580 WP_000999947.1.15809 WP_000999947.1.1582 WP_000999947.1.15855 WP_000999947.1.15863 WP_000999947.1.1588 WP_000999947.1.15894 WP_000999947.1.15906 WP_000999947.1.15916 WP_000999947.1.15945 WP_000999947.1.15949 WP_000999947.1.15951 WP_000999947.1.15983 WP_000999947.1.16014 WP_000999947.1.16015 WP_000999947.1.16034 WP_000999947.1.1604 WP_000999947.1.16042 WP_000999947.1.16067 WP_000999947.1.16086 WP_000999947.1.16087 WP_000999947.1.1609 WP_000999947.1.16102 WP_000999947.1.16111 WP_000999947.1.16154 WP_000999947.1.16171 WP_000999947.1.16179 WP_000999947.1.16188 WP_000999947.1.1621 WP_000999947.1.16270 WP_000999947.1.16294 WP_000999947.1.163 WP_000999947.1.16303 WP_000999947.1.16322 WP_000999947.1.1634 WP_000999947.1.16387 WP_000999947.1.16388 WP_000999947.1.16396 WP_000999947.1.1640 WP_000999947.1.16435 WP_000999947.1.16482 WP_000999947.1.16517 WP_000999947.1.16532 WP_000999947.1.16539 WP_000999947.1.16541 WP_000999947.1.16577 WP_000999947.1.16592 WP_000999947.1.16604 WP_000999947.1.16640 WP_000999947.1.16648 WP_000999947.1.16667 WP_000999947.1.16669 WP_000999947.1.16682 WP_000999947.1.16685 WP_000999947.1.16700 WP_000999947.1.16715 WP_000999947.1.16721 WP_000999947.1.1673 WP_000999947.1.16745 WP_000999947.1.16752 WP_000999947.1.16766 WP_000999947.1.16798 WP_000999947.1.16805 WP_000999947.1.16807 WP_000999947.1.16818 WP_000999947.1.16861 WP_000999947.1.16894 WP_000999947.1.16970 WP_000999947.1.16992 WP_000999947.1.17014 WP_000999947.1.17017 WP_000999947.1.17018 WP_000999947.1.17028 WP_000999947.1.17042 WP_000999947.1.17084 WP_000999947.1.17085 WP_000999947.1.17087 WP_000999947.1.17089 WP_000999947.1.1710 WP_000999947.1.17101 WP_000999947.1.17102 WP_000999947.1.17109 WP_000999947.1.17111 WP_000999947.1.17114 WP_000999947.1.17123 WP_000999947.1.17170 WP_000999947.1.17172 WP_000999947.1.17186 WP_000999947.1.17205 WP_000999947.1.17206 WP_000999947.1.17216 WP_000999947.1.17230 WP_000999947.1.17242 WP_000999947.1.1726 WP_000999947.1.17290 WP_000999947.1.17297 WP_000999947.1.17300 WP_000999947.1.17301 WP_000999947.1.17333 WP_000999947.1.17356 WP_000999947.1.17373 WP_000999947.1.17387 WP_000999947.1.17389 WP_000999947.1.17392 WP_000999947.1.17403 WP_000999947.1.17410 WP_000999947.1.17417 WP_000999947.1.17432 WP_000999947.1.17441 WP_000999947.1.17534 WP_000999947.1.1754 WP_000999947.1.1755 WP_000999947.1.17568 WP_000999947.1.17577 WP_000999947.1.17595 WP_000999947.1.17623 WP_000999947.1.1763 WP_000999947.1.17637 WP_000999947.1.1769 WP_000999947.1.17701 WP_000999947.1.1772 WP_000999947.1.17765 WP_000999947.1.17769 WP_000999947.1.1778 WP_000999947.1.17802 WP_000999947.1.17829 WP_000999947.1.17836 WP_000999947.1.17889 WP_000999947.1.17920 WP_000999947.1.17925 WP_000999947.1.17937 WP_000999947.1.17961 WP_000999947.1.17963 WP_000999947.1.17984 WP_000999947.1.18000 WP_000999947.1.18006 WP_000999947.1.18024 WP_000999947.1.18050 WP_000999947.1.18064 WP_000999947.1.18094 WP_000999947.1.18112 WP_000999947.1.18118 WP_000999947.1.18121 WP_000999947.1.18133 WP_000999947.1.18134 WP_000999947.1.18141 WP_000999947.1.18226 WP_000999947.1.18229 WP_000999947.1.18275 WP_000999947.1.18311 WP_000999947.1.18316 WP_000999947.1.18329 WP_000999947.1.18338 WP_000999947.1.18348 WP_000999947.1.18354 WP_000999947.1.18381 WP_000999947.1.18383 WP_000999947.1.18394 WP_000999947.1.18402 WP_000999947.1.18410 WP_000999947.1.18436 WP_000999947.1.18438 WP_000999947.1.1844 WP_000999947.1.18458 WP_000999947.1.18472 WP_000999947.1.18482 WP_000999947.1.18511 WP_000999947.1.18519 WP_000999947.1.18530 WP_000999947.1.18550 WP_000999947.1.18556 WP_000999947.1.18581 WP_000999947.1.18583 WP_000999947.1.1861 WP_000999947.1.18617 WP_000999947.1.18628 WP_000999947.1.18649 WP_000999947.1.18650 WP_000999947.1.18651 WP_000999947.1.18655 WP_000999947.1.1866 WP_000999947.1.1867 WP_000999947.1.18675 WP_000999947.1.18699 WP_000999947.1.18714 WP_000999947.1.18726 WP_000999947.1.1873 WP_000999947.1.18734 WP_000999947.1.18794 WP_000999947.1.188 WP_000999947.1.18806 WP_000999947.1.18843 WP_000999947.1.18858 WP_000999947.1.18861 WP_000999947.1.18874 WP_000999947.1.18876 WP_000999947.1.18899 WP_000999947.1.18923 WP_000999947.1.18936 WP_000999947.1.18966 WP_000999947.1.18983 WP_000999947.1.1903 WP_000999947.1.1906 WP_000999947.1.1909 WP_000999947.1.19090 WP_000999947.1.19100 WP_000999947.1.19113 WP_000999947.1.19114 WP_000999947.1.19122 WP_000999947.1.19147 WP_000999947.1.1915 WP_000999947.1.19150 WP_000999947.1.19153 WP_000999947.1.19205 WP_000999947.1.1925 WP_000999947.1.19276 WP_000999947.1.19277 WP_000999947.1.19297 WP_000999947.1.193 WP_000999947.1.19312 WP_000999947.1.19313 WP_000999947.1.19314 WP_000999947.1.19315 WP_000999947.1.19332 WP_000999947.1.19338 WP_000999947.1.19347 WP_000999947.1.19389 WP_000999947.1.19397 WP_000999947.1.19419 WP_000999947.1.19424 WP_000999947.1.19441 WP_000999947.1.19448 WP_000999947.1.19478 WP_000999947.1.19487 WP_000999947.1.19494 WP_000999947.1.1952 WP_000999947.1.19534 WP_000999947.1.19544 WP_000999947.1.19547 WP_000999947.1.19557 WP_000999947.1.19581 WP_000999947.1.19583 WP_000999947.1.19593 WP_000999947.1.19602 WP_000999947.1.1963 WP_000999947.1.19644 WP_000999947.1.19655 WP_000999947.1.19661 WP_000999947.1.19684 WP_000999947.1.19691 WP_000999947.1.19758 WP_000999947.1.19778 WP_000999947.1.1982 WP_000999947.1.19830 WP_000999947.1.19838 WP_000999947.1.19845 WP_000999947.1.19861 WP_000999947.1.19873 WP_000999947.1.19889 WP_000999947.1.19940 WP_000999947.1.19945 WP_000999947.1.19957 WP_000999947.1.19994 WP_000999947.1.20025 WP_000999947.1.20096 WP_000999947.1.20114 WP_000999947.1.20129 WP_000999947.1.20133 WP_000999947.1.20151 WP_000999947.1.20157 WP_000999947.1.20159 WP_000999947.1.20164 WP_000999947.1.20166 WP_000999947.1.20178 WP_000999947.1.20183 WP_000999947.1.20192 WP_000999947.1.20215 WP_000999947.1.2022 WP_000999947.1.20230 WP_000999947.1.20238 WP_000999947.1.20251 WP_000999947.1.20264 WP_000999947.1.20277 WP_000999947.1.20290 WP_000999947.1.20318 WP_000999947.1.20325 WP_000999947.1.20331 WP_000999947.1.20334 WP_000999947.1.20370 WP_000999947.1.20388 WP_000999947.1.20445 WP_000999947.1.20483 WP_000999947.1.20493 WP_000999947.1.20506 WP_000999947.1.20519 WP_000999947.1.20536 WP_000999947.1.20549 WP_000999947.1.20565 WP_000999947.1.20596 WP_000999947.1.20609 WP_000999947.1.2063 WP_000999947.1.20630 WP_000999947.1.20636 WP_000999947.1.20638 WP_000999947.1.20662 WP_000999947.1.20668 WP_000999947.1.20724 WP_000999947.1.20730 WP_000999947.1.20737 WP_000999947.1.20741 WP_000999947.1.2075 WP_000999947.1.20765 WP_000999947.1.20785 WP_000999947.1.20813 WP_000999947.1.20824 WP_000999947.1.20831 WP_000999947.1.20841 WP_000999947.1.20848 WP_000999947.1.20863 WP_000999947.1.2093 WP_000999947.1.2094 WP_000999947.1.20943 WP_000999947.1.20958 WP_000999947.1.20982 WP_000999947.1.2100 WP_000999947.1.21020 WP_000999947.1.21022 WP_000999947.1.21033 WP_000999947.1.21041 WP_000999947.1.21057 WP_000999947.1.21059 WP_000999947.1.21104 WP_000999947.1.21122 WP_000999947.1.21129 WP_000999947.1.2113 WP_000999947.1.21131 WP_000999947.1.21137 WP_000999947.1.21152 WP_000999947.1.21171 WP_000999947.1.21197 WP_000999947.1.21236 WP_000999947.1.21248 WP_000999947.1.21251 WP_000999947.1.21255 WP_000999947.1.21266 WP_000999947.1.21277 WP_000999947.1.21305 WP_000999947.1.21320 WP_000999947.1.21336 WP_000999947.1.21378 WP_000999947.1.2142 WP_000999947.1.21441 WP_000999947.1.21455 WP_000999947.1.21470 WP_000999947.1.21519 WP_000999947.1.21537 WP_000999947.1.2156 WP_000999947.1.21573 WP_000999947.1.21578 WP_000999947.1.21596 WP_000999947.1.21628 WP_000999947.1.21637 WP_000999947.1.2164 WP_000999947.1.21656 WP_000999947.1.21661 WP_000999947.1.21667 WP_000999947.1.21673 WP_000999947.1.21696 WP_000999947.1.21727 WP_000999947.1.21732 WP_000999947.1.21733 WP_000999947.1.21756 WP_000999947.1.21758 WP_000999947.1.21762 WP_000999947.1.21771 WP_000999947.1.21811 WP_000999947.1.21812 WP_000999947.1.21823 WP_000999947.1.21887 WP_000999947.1.21895 WP_000999947.1.21915 WP_000999947.1.21945 WP_000999947.1.21948 WP_000999947.1.2198 WP_000999947.1.21986 WP_000999947.1.21992 WP_000999947.1.22021 WP_000999947.1.22060 WP_000999947.1.22113 WP_000999947.1.22138 WP_000999947.1.22161 WP_000999947.1.22195 WP_000999947.1.22203 WP_000999947.1.22204 WP_000999947.1.22268 WP_000999947.1.22269 WP_000999947.1.22272 WP_000999947.1.22291 WP_000999947.1.22295 WP_000999947.1.2232 WP_000999947.1.22325 WP_000999947.1.22350 WP_000999947.1.22363 WP_000999947.1.2242 WP_000999947.1.22450 WP_000999947.1.22464 WP_000999947.1.22470 WP_000999947.1.22494 WP_000999947.1.22501 WP_000999947.1.22544 WP_000999947.1.22571 WP_000999947.1.22572 WP_000999947.1.22574 WP_000999947.1.22576 WP_000999947.1.22579 WP_000999947.1.22599 WP_000999947.1.22602 WP_000999947.1.22631 WP_000999947.1.22632 WP_000999947.1.22641 WP_000999947.1.22662 WP_000999947.1.22669 WP_000999947.1.22685 WP_000999947.1.22690 WP_000999947.1.22756 WP_000999947.1.22765 WP_000999947.1.22777 WP_000999947.1.22809 WP_000999947.1.22814 WP_000999947.1.22824 WP_000999947.1.22827 WP_000999947.1.22830 WP_000999947.1.22846 WP_000999947.1.22868 WP_000999947.1.22875 WP_000999947.1.22878 WP_000999947.1.22885 WP_000999947.1.22908 WP_000999947.1.22917 WP_000999947.1.22961 WP_000999947.1.22988 WP_000999947.1.22990 WP_000999947.1.22993 WP_000999947.1.2300 WP_000999947.1.23005 WP_000999947.1.23026 WP_000999947.1.23035 WP_000999947.1.23044 WP_000999947.1.23045 WP_000999947.1.23057 WP_000999947.1.23062 WP_000999947.1.23078 WP_000999947.1.23081 WP_000999947.1.23090 WP_000999947.1.23092 WP_000999947.1.23105 WP_000999947.1.23109 WP_000999947.1.23120 WP_000999947.1.23257 WP_000999947.1.23270 WP_000999947.1.23285 WP_000999947.1.23290 WP_000999947.1.23293 WP_000999947.1.23299 WP_000999947.1.23351 WP_000999947.1.23352 WP_000999947.1.23376 WP_000999947.1.23378 WP_000999947.1.23383 WP_000999947.1.23388 WP_000999947.1.23393 WP_000999947.1.23443 WP_000999947.1.23456 WP_000999947.1.23463 WP_000999947.1.23486 WP_000999947.1.23487 WP_000999947.1.23511 WP_000999947.1.23520 WP_000999947.1.23522 WP_000999947.1.23527 WP_000999947.1.2353 WP_000999947.1.23549 WP_000999947.1.23554 WP_000999947.1.23561 WP_000999947.1.23563 WP_000999947.1.23584 WP_000999947.1.23593 WP_000999947.1.23625 WP_000999947.1.23640 WP_000999947.1.23660 WP_000999947.1.23693 WP_000999947.1.23729 WP_000999947.1.23741 WP_000999947.1.23752 WP_000999947.1.23754 WP_000999947.1.23765 WP_000999947.1.23795 WP_000999947.1.23804 WP_000999947.1.23812 WP_000999947.1.23840 WP_000999947.1.23855 WP_000999947.1.23881 WP_000999947.1.23886 WP_000999947.1.23890 WP_000999947.1.23898 WP_000999947.1.23914 WP_000999947.1.23915 WP_000999947.1.23931 WP_000999947.1.23945 WP_000999947.1.23950 WP_000999947.1.23953 WP_000999947.1.23960 WP_000999947.1.23970 WP_000999947.1.23971 WP_000999947.1.24 WP_000999947.1.24024 WP_000999947.1.24045 WP_000999947.1.24051 WP_000999947.1.24058 WP_000999947.1.24068 WP_000999947.1.24089 WP_000999947.1.24120 WP_000999947.1.24122 WP_000999947.1.24124 WP_000999947.1.24127 WP_000999947.1.2413 WP_000999947.1.24136 WP_000999947.1.2418 WP_000999947.1.24194 WP_000999947.1.24233 WP_000999947.1.24278 WP_000999947.1.2428 WP_000999947.1.24290 WP_000999947.1.2430 WP_000999947.1.24304 WP_000999947.1.24362 WP_000999947.1.2437 WP_000999947.1.24374 WP_000999947.1.24381 WP_000999947.1.24383 WP_000999947.1.24458 WP_000999947.1.24460 WP_000999947.1.24473 WP_000999947.1.24483 WP_000999947.1.24485 WP_000999947.1.2449 WP_000999947.1.24523 WP_000999947.1.24533 WP_000999947.1.24536 WP_000999947.1.2456 WP_000999947.1.24560 WP_000999947.1.24570 WP_000999947.1.24575 WP_000999947.1.24583 WP_000999947.1.24616 WP_000999947.1.24634 WP_000999947.1.24641 WP_000999947.1.24642 WP_000999947.1.24646 WP_000999947.1.24650 WP_000999947.1.2469 WP_000999947.1.24693 WP_000999947.1.24695 WP_000999947.1.24758 WP_000999947.1.24773 WP_000999947.1.24783 WP_000999947.1.2479 WP_000999947.1.24791 WP_000999947.1.24799 WP_000999947.1.24808 WP_000999947.1.24849 WP_000999947.1.24854 WP_000999947.1.24876 WP_000999947.1.24899 WP_000999947.1.24906 WP_000999947.1.24926 WP_000999947.1.24929 WP_000999947.1.24939 WP_000999947.1.24946 WP_000999947.1.24968 WP_000999947.1.24979 WP_000999947.1.24981 WP_000999947.1.24982 WP_000999947.1.24984 WP_000999947.1.25019 WP_000999947.1.25039 WP_000999947.1.2504 WP_000999947.1.25060 WP_000999947.1.25085 WP_000999947.1.25086 WP_000999947.1.25087 WP_000999947.1.25141 WP_000999947.1.25183 WP_000999947.1.25193 WP_000999947.1.25203 WP_000999947.1.25204 WP_000999947.1.25272 WP_000999947.1.25289 WP_000999947.1.2531 WP_000999947.1.25324 WP_000999947.1.25346 WP_000999947.1.2537 WP_000999947.1.25378 WP_000999947.1.25380 WP_000999947.1.254 WP_000999947.1.25403 WP_000999947.1.25414 WP_000999947.1.25420 WP_000999947.1.2543 WP_000999947.1.25446 WP_000999947.1.25480 WP_000999947.1.255 WP_000999947.1.25517 WP_000999947.1.25525 WP_000999947.1.25548 WP_000999947.1.2558 WP_000999947.1.25592 WP_000999947.1.25598 WP_000999947.1.25602 WP_000999947.1.25613 WP_000999947.1.25631 WP_000999947.1.25652 WP_000999947.1.2567 WP_000999947.1.25681 WP_000999947.1.25701 WP_000999947.1.25713 WP_000999947.1.25717 WP_000999947.1.25718 WP_000999947.1.25724 WP_000999947.1.25726 WP_000999947.1.25750 WP_000999947.1.25753 WP_000999947.1.25755 WP_000999947.1.25832 WP_000999947.1.25843 WP_000999947.1.25855 WP_000999947.1.25869 WP_000999947.1.25873 WP_000999947.1.2588 WP_000999947.1.25886 WP_000999947.1.2589 WP_000999947.1.25895 WP_000999947.1.25915 WP_000999947.1.25945 WP_000999947.1.25996 WP_000999947.1.26048 WP_000999947.1.26055 WP_000999947.1.26061 WP_000999947.1.26076 WP_000999947.1.26100 WP_000999947.1.2612 WP_000999947.1.26130 WP_000999947.1.26135 WP_000999947.1.26150 WP_000999947.1.26161 WP_000999947.1.26186 WP_000999947.1.26189 WP_000999947.1.26191 WP_000999947.1.26262 WP_000999947.1.26264 WP_000999947.1.26270 WP_000999947.1.26304 WP_000999947.1.26325 WP_000999947.1.26331 WP_000999947.1.26379 WP_000999947.1.26391 WP_000999947.1.26401 WP_000999947.1.26403 WP_000999947.1.26419 WP_000999947.1.2642 WP_000999947.1.26438 WP_000999947.1.26443 WP_000999947.1.26467 WP_000999947.1.26479 WP_000999947.1.26480 WP_000999947.1.26517 WP_000999947.1.26569 WP_000999947.1.26570 WP_000999947.1.26575 WP_000999947.1.26588 WP_000999947.1.26598 WP_000999947.1.26609 WP_000999947.1.26613 WP_000999947.1.26644 WP_000999947.1.2665 WP_000999947.1.26658 WP_000999947.1.26683 WP_000999947.1.26716 WP_000999947.1.26720 WP_000999947.1.26736 WP_000999947.1.26766 WP_000999947.1.26839 WP_000999947.1.26912 WP_000999947.1.2694 WP_000999947.1.26941 WP_000999947.1.26943 WP_000999947.1.2695 WP_000999947.1.26950 WP_000999947.1.26987 WP_000999947.1.26995 WP_000999947.1.27019 WP_000999947.1.27043 WP_000999947.1.27057 WP_000999947.1.27060 WP_000999947.1.27091 WP_000999947.1.27101 WP_000999947.1.27105 WP_000999947.1.2712 WP_000999947.1.27134 WP_000999947.1.27141 WP_000999947.1.27148 WP_000999947.1.27175 WP_000999947.1.27234 WP_000999947.1.27260 WP_000999947.1.27280 WP_000999947.1.27283 WP_000999947.1.27287 WP_000999947.1.27292 WP_000999947.1.2731 WP_000999947.1.27310 WP_000999947.1.27313 WP_000999947.1.27330 WP_000999947.1.27367 WP_000999947.1.27373 WP_000999947.1.27396 WP_000999947.1.27401 WP_000999947.1.27424 WP_000999947.1.27451 WP_000999947.1.27504 WP_000999947.1.27524 WP_000999947.1.27560 WP_000999947.1.27580 WP_000999947.1.27585 WP_000999947.1.27683 WP_000999947.1.27691 WP_000999947.1.27693 WP_000999947.1.27698 WP_000999947.1.27723 WP_000999947.1.27734 WP_000999947.1.27741 WP_000999947.1.27749 WP_000999947.1.27758 WP_000999947.1.27774 WP_000999947.1.27786 WP_000999947.1.2782 WP_000999947.1.27856 WP_000999947.1.27876 WP_000999947.1.27879 WP_000999947.1.27897 WP_000999947.1.27913 WP_000999947.1.27923 WP_000999947.1.27971 WP_000999947.1.27998 WP_000999947.1.28026 WP_000999947.1.28102 WP_000999947.1.28109 WP_000999947.1.2811 WP_000999947.1.28110 WP_000999947.1.28128 WP_000999947.1.28156 WP_000999947.1.28167 WP_000999947.1.28168 WP_000999947.1.28184 WP_000999947.1.2823 WP_000999947.1.2826 WP_000999947.1.28268 WP_000999947.1.28271 WP_000999947.1.28305 WP_000999947.1.28318 WP_000999947.1.28322 WP_000999947.1.28349 WP_000999947.1.28401 WP_000999947.1.28414 WP_000999947.1.28433 WP_000999947.1.28440 WP_000999947.1.28461 WP_000999947.1.28476 WP_000999947.1.28480 WP_000999947.1.28496 WP_000999947.1.28509 WP_000999947.1.28523 WP_000999947.1.28540 WP_000999947.1.28544 WP_000999947.1.28554 WP_000999947.1.28568 WP_000999947.1.28639 WP_000999947.1.28662 WP_000999947.1.28683 WP_000999947.1.28697 WP_000999947.1.28711 WP_000999947.1.28742 WP_000999947.1.28760 WP_000999947.1.28762 WP_000999947.1.28769 WP_000999947.1.28791 WP_000999947.1.28809 WP_000999947.1.2881 WP_000999947.1.28829 WP_000999947.1.28835 WP_000999947.1.28919 WP_000999947.1.28950 WP_000999947.1.28953 WP_000999947.1.28982 WP_000999947.1.28994 WP_000999947.1.290 WP_000999947.1.29001 WP_000999947.1.29016 WP_000999947.1.29026 WP_000999947.1.29055 WP_000999947.1.29061 WP_000999947.1.29079 WP_000999947.1.29082 WP_000999947.1.29100 WP_000999947.1.29118 WP_000999947.1.29125 WP_000999947.1.29128 WP_000999947.1.29146 WP_000999947.1.29150 WP_000999947.1.29176 WP_000999947.1.29194 WP_000999947.1.29197 WP_000999947.1.29202 WP_000999947.1.29206 WP_000999947.1.29221 WP_000999947.1.29239 WP_000999947.1.29252 WP_000999947.1.2926 WP_000999947.1.2942 WP_000999947.1.29429 WP_000999947.1.2945 WP_000999947.1.29486 WP_000999947.1.29495 WP_000999947.1.29497 WP_000999947.1.29503 WP_000999947.1.29504 WP_000999947.1.2952 WP_000999947.1.2954 WP_000999947.1.29556 WP_000999947.1.29590 WP_000999947.1.29643 WP_000999947.1.29669 WP_000999947.1.29683 WP_000999947.1.29689 WP_000999947.1.29699 WP_000999947.1.29715 WP_000999947.1.29724 WP_000999947.1.29740 WP_000999947.1.29746 WP_000999947.1.29752 WP_000999947.1.29798 WP_000999947.1.29812 WP_000999947.1.29821 WP_000999947.1.29840 WP_000999947.1.2986 WP_000999947.1.29874 WP_000999947.1.29876 WP_000999947.1.29884 WP_000999947.1.29933 WP_000999947.1.2995 WP_000999947.1.29967 WP_000999947.1.29992 WP_000999947.1.30004 WP_000999947.1.30016 WP_000999947.1.30035 WP_000999947.1.30063 WP_000999947.1.30098 WP_000999947.1.30105 WP_000999947.1.30141 WP_000999947.1.30221 WP_000999947.1.30231 WP_000999947.1.30232 WP_000999947.1.30239 WP_000999947.1.30247 WP_000999947.1.30253 WP_000999947.1.30347 WP_000999947.1.30401 WP_000999947.1.30428 WP_000999947.1.30452 WP_000999947.1.30472 WP_000999947.1.30479 WP_000999947.1.30497 WP_000999947.1.30546 WP_000999947.1.30554 WP_000999947.1.30580 WP_000999947.1.306 WP_000999947.1.3063 WP_000999947.1.30630 WP_000999947.1.30639 WP_000999947.1.30665 WP_000999947.1.30700 WP_000999947.1.30733 WP_000999947.1.30742 WP_000999947.1.30749 WP_000999947.1.30762 WP_000999947.1.30843 WP_000999947.1.30853 WP_000999947.1.30867 WP_000999947.1.30879 WP_000999947.1.30906 WP_000999947.1.30960 WP_000999947.1.30987 WP_000999947.1.31009 WP_000999947.1.31017 WP_000999947.1.31026 WP_000999947.1.31083 WP_000999947.1.31089 WP_000999947.1.31142 WP_000999947.1.31149 WP_000999947.1.31188 WP_000999947.1.31211 WP_000999947.1.31295 WP_000999947.1.31319 WP_000999947.1.31340 WP_000999947.1.31353 WP_000999947.1.31357 WP_000999947.1.31379 WP_000999947.1.31407 WP_000999947.1.31419 WP_000999947.1.31421 WP_000999947.1.31422 WP_000999947.1.31429 WP_000999947.1.31431 WP_000999947.1.31433 WP_000999947.1.31434 WP_000999947.1.3147 WP_000999947.1.31482 WP_000999947.1.31511 WP_000999947.1.31518 WP_000999947.1.31521 WP_000999947.1.31527 WP_000999947.1.31542 WP_000999947.1.31557 WP_000999947.1.31614 WP_000999947.1.31618 WP_000999947.1.31625 WP_000999947.1.31639 WP_000999947.1.31675 WP_000999947.1.31679 WP_000999947.1.31681 WP_000999947.1.3169 WP_000999947.1.31696 WP_000999947.1.31709 WP_000999947.1.31736 WP_000999947.1.31740 WP_000999947.1.31801 WP_000999947.1.31803 WP_000999947.1.31809 WP_000999947.1.3181 WP_000999947.1.31833 WP_000999947.1.31835 WP_000999947.1.31839 WP_000999947.1.31860 WP_000999947.1.31866 WP_000999947.1.31899 WP_000999947.1.31903 WP_000999947.1.31924 WP_000999947.1.31928 WP_000999947.1.3193 WP_000999947.1.31937 WP_000999947.1.31978 WP_000999947.1.32020 WP_000999947.1.32021 WP_000999947.1.3203 WP_000999947.1.32037 WP_000999947.1.32049 WP_000999947.1.32078 WP_000999947.1.32089 WP_000999947.1.32091 WP_000999947.1.32093 WP_000999947.1.32121 WP_000999947.1.32138 WP_000999947.1.32142 WP_000999947.1.32143 WP_000999947.1.3215 WP_000999947.1.32173 WP_000999947.1.32184 WP_000999947.1.32222 WP_000999947.1.32232 WP_000999947.1.32236 WP_000999947.1.32242 WP_000999947.1.32279 WP_000999947.1.32287 WP_000999947.1.3233 WP_000999947.1.32333 WP_000999947.1.32394 WP_000999947.1.32406 WP_000999947.1.32432 WP_000999947.1.32435 WP_000999947.1.32443 WP_000999947.1.32448 WP_000999947.1.3247 WP_000999947.1.32475 WP_000999947.1.32479 WP_000999947.1.3248 WP_000999947.1.32494 WP_000999947.1.32509 WP_000999947.1.32558 WP_000999947.1.32580 WP_000999947.1.3259 WP_000999947.1.32591 WP_000999947.1.32601 WP_000999947.1.32635 WP_000999947.1.32655 WP_000999947.1.32661 WP_000999947.1.32676 WP_000999947.1.32680 WP_000999947.1.3269 WP_000999947.1.327 WP_000999947.1.32709 WP_000999947.1.32715 WP_000999947.1.32720 WP_000999947.1.32741 WP_000999947.1.32811 WP_000999947.1.32815 WP_000999947.1.32831 WP_000999947.1.32835 WP_000999947.1.32875 WP_000999947.1.32903 WP_000999947.1.32910 WP_000999947.1.32938 WP_000999947.1.32959 WP_000999947.1.32984 WP_000999947.1.32992 WP_000999947.1.32995 WP_000999947.1.33004 WP_000999947.1.33014 WP_000999947.1.33018 WP_000999947.1.33022 WP_000999947.1.33026 WP_000999947.1.33053 WP_000999947.1.33101 WP_000999947.1.33119 WP_000999947.1.33171 WP_000999947.1.33179 WP_000999947.1.33222 WP_000999947.1.3323 WP_000999947.1.33237 WP_000999947.1.33244 WP_000999947.1.33303 WP_000999947.1.33325 WP_000999947.1.33341 WP_000999947.1.33362 WP_000999947.1.33369 WP_000999947.1.33385 WP_000999947.1.334 WP_000999947.1.33408 WP_000999947.1.33410 WP_000999947.1.33413 WP_000999947.1.33422 WP_000999947.1.33424 WP_000999947.1.33428 WP_000999947.1.3344 WP_000999947.1.33475 WP_000999947.1.33476 WP_000999947.1.33502 WP_000999947.1.33512 WP_000999947.1.33526 WP_000999947.1.3354 WP_000999947.1.33545 WP_000999947.1.33565 WP_000999947.1.33595 WP_000999947.1.33638 WP_000999947.1.33648 WP_000999947.1.33667 WP_000999947.1.33680 WP_000999947.1.33729 WP_000999947.1.33736 WP_000999947.1.33745 WP_000999947.1.33746 WP_000999947.1.33780 WP_000999947.1.33799 WP_000999947.1.33823 WP_000999947.1.33853 WP_000999947.1.33854 WP_000999947.1.33879 WP_000999947.1.33888 WP_000999947.1.33896 WP_000999947.1.33914 WP_000999947.1.33952 WP_000999947.1.33973 WP_000999947.1.33979 WP_000999947.1.3398 WP_000999947.1.34003 WP_000999947.1.3401 WP_000999947.1.34032 WP_000999947.1.34094 WP_000999947.1.3411 WP_000999947.1.34121 WP_000999947.1.34122 WP_000999947.1.34124 WP_000999947.1.34144 WP_000999947.1.3415 WP_000999947.1.342 WP_000999947.1.34204 WP_000999947.1.34206 WP_000999947.1.34224 WP_000999947.1.34273 WP_000999947.1.34277 WP_000999947.1.34332 WP_000999947.1.34341 WP_000999947.1.34348 WP_000999947.1.34363 WP_000999947.1.34380 WP_000999947.1.3439 WP_000999947.1.34397 WP_000999947.1.34400 WP_000999947.1.3444 WP_000999947.1.34440 WP_000999947.1.34441 WP_000999947.1.34444 WP_000999947.1.34456 WP_000999947.1.34464 WP_000999947.1.34470 WP_000999947.1.34525 WP_000999947.1.34532 WP_000999947.1.34538 WP_000999947.1.34541 WP_000999947.1.34557 WP_000999947.1.34558 WP_000999947.1.3460 WP_000999947.1.34605 WP_000999947.1.34655 WP_000999947.1.34668 WP_000999947.1.34675 WP_000999947.1.34682 WP_000999947.1.3469 WP_000999947.1.347 WP_000999947.1.3472 WP_000999947.1.34727 WP_000999947.1.34781 WP_000999947.1.34782 WP_000999947.1.34794 WP_000999947.1.34827 WP_000999947.1.34838 WP_000999947.1.34855 WP_000999947.1.34875 WP_000999947.1.34887 WP_000999947.1.34931 WP_000999947.1.34948 WP_000999947.1.34966 WP_000999947.1.34983 WP_000999947.1.34990 WP_000999947.1.34993 WP_000999947.1.35003 WP_000999947.1.35006 WP_000999947.1.35007 WP_000999947.1.35012 WP_000999947.1.35114 WP_000999947.1.35132 WP_000999947.1.3515 WP_000999947.1.35168 WP_000999947.1.35186 WP_000999947.1.35195 WP_000999947.1.35198 WP_000999947.1.35202 WP_000999947.1.35204 WP_000999947.1.35208 WP_000999947.1.3521 WP_000999947.1.35211 WP_000999947.1.35220 WP_000999947.1.35316 WP_000999947.1.35349 WP_000999947.1.35360 WP_000999947.1.35365 WP_000999947.1.35376 WP_000999947.1.3539 WP_000999947.1.35398 WP_000999947.1.35448 WP_000999947.1.35464 WP_000999947.1.35465 WP_000999947.1.35466 WP_000999947.1.35468 WP_000999947.1.35552 WP_000999947.1.3560 WP_000999947.1.35604 WP_000999947.1.35627 WP_000999947.1.35651 WP_000999947.1.35653 WP_000999947.1.35654 WP_000999947.1.35724 WP_000999947.1.35740 WP_000999947.1.35744 WP_000999947.1.35789 WP_000999947.1.35904 WP_000999947.1.35922 WP_000999947.1.35927 WP_000999947.1.35934 WP_000999947.1.35942 WP_000999947.1.35959 WP_000999947.1.35963 WP_000999947.1.35987 WP_000999947.1.36040 WP_000999947.1.36042 WP_000999947.1.36071 WP_000999947.1.36085 WP_000999947.1.36094 WP_000999947.1.36105 WP_000999947.1.36159 WP_000999947.1.36164 WP_000999947.1.36166 WP_000999947.1.36177 WP_000999947.1.36182 WP_000999947.1.3620 WP_000999947.1.36207 WP_000999947.1.36281 WP_000999947.1.36299 WP_000999947.1.36332 WP_000999947.1.36334 WP_000999947.1.36352 WP_000999947.1.36386 WP_000999947.1.36393 WP_000999947.1.36405 WP_000999947.1.36412 WP_000999947.1.36426 WP_000999947.1.3643 WP_000999947.1.36453 WP_000999947.1.36496 WP_000999947.1.36500 WP_000999947.1.36507 WP_000999947.1.36523 WP_000999947.1.36537 WP_000999947.1.36610 WP_000999947.1.36628 WP_000999947.1.3668 WP_000999947.1.36707 WP_000999947.1.3671 WP_000999947.1.36724 WP_000999947.1.36746 WP_000999947.1.36761 WP_000999947.1.36806 WP_000999947.1.36812 WP_000999947.1.36817 WP_000999947.1.36826 WP_000999947.1.36833 WP_000999947.1.36856 WP_000999947.1.36886 WP_000999947.1.36925 WP_000999947.1.3697 WP_000999947.1.36971 WP_000999947.1.36975 WP_000999947.1.37006 WP_000999947.1.37020 WP_000999947.1.37046 WP_000999947.1.37049 WP_000999947.1.37076 WP_000999947.1.37099 WP_000999947.1.37101 WP_000999947.1.37146 WP_000999947.1.37153 WP_000999947.1.37206 WP_000999947.1.3723 WP_000999947.1.37233 WP_000999947.1.37252 WP_000999947.1.37261 WP_000999947.1.37290 WP_000999947.1.3730 WP_000999947.1.37306 WP_000999947.1.37329 WP_000999947.1.37334 WP_000999947.1.37342 WP_000999947.1.37352 WP_000999947.1.37360 WP_000999947.1.37371 WP_000999947.1.37419 WP_000999947.1.37423 WP_000999947.1.37433 WP_000999947.1.37445 WP_000999947.1.37472 WP_000999947.1.37476 WP_000999947.1.37485 WP_000999947.1.3749 WP_000999947.1.37510 WP_000999947.1.37516 WP_000999947.1.37538 WP_000999947.1.37543 WP_000999947.1.37544 WP_000999947.1.37548 WP_000999947.1.37550 WP_000999947.1.37554 WP_000999947.1.37576 WP_000999947.1.37588 WP_000999947.1.37634 WP_000999947.1.377 WP_000999947.1.3772 WP_000999947.1.37745 WP_000999947.1.37750 WP_000999947.1.37758 WP_000999947.1.37762 WP_000999947.1.37773 WP_000999947.1.37817 WP_000999947.1.37847 WP_000999947.1.37852 WP_000999947.1.3788 WP_000999947.1.37880 WP_000999947.1.37887 WP_000999947.1.37897 WP_000999947.1.37917 WP_000999947.1.37923 WP_000999947.1.37926 WP_000999947.1.37940 WP_000999947.1.37964 WP_000999947.1.37995 WP_000999947.1.37998 WP_000999947.1.38000 WP_000999947.1.38033 WP_000999947.1.38043 WP_000999947.1.38080 WP_000999947.1.38081 WP_000999947.1.38085 WP_000999947.1.38103 WP_000999947.1.38105 WP_000999947.1.3811 WP_000999947.1.38120 WP_000999947.1.3815 WP_000999947.1.38162 WP_000999947.1.38182 WP_000999947.1.3822 WP_000999947.1.38234 WP_000999947.1.38264 WP_000999947.1.38300 WP_000999947.1.38314 WP_000999947.1.38323 WP_000999947.1.38363 WP_000999947.1.38371 WP_000999947.1.38412 WP_000999947.1.38419 WP_000999947.1.38561 WP_000999947.1.38584 WP_000999947.1.38610 WP_000999947.1.38626 WP_000999947.1.38629 WP_000999947.1.38636 WP_000999947.1.38694 WP_000999947.1.3873 WP_000999947.1.38751 WP_000999947.1.38777 WP_000999947.1.38811 WP_000999947.1.38827 WP_000999947.1.38835 WP_000999947.1.38896 WP_000999947.1.38911 WP_000999947.1.38920 WP_000999947.1.38935 WP_000999947.1.38950 WP_000999947.1.39005 WP_000999947.1.39015 WP_000999947.1.3903 WP_000999947.1.39037 WP_000999947.1.3904 WP_000999947.1.39042 WP_000999947.1.39103 WP_000999947.1.39111 WP_000999947.1.3912 WP_000999947.1.39123 WP_000999947.1.39148 WP_000999947.1.39150 WP_000999947.1.39155 WP_000999947.1.39157 WP_000999947.1.39164 WP_000999947.1.39171 WP_000999947.1.39184 WP_000999947.1.39196 WP_000999947.1.3921 WP_000999947.1.3922 WP_000999947.1.39232 WP_000999947.1.39249 WP_000999947.1.39254 WP_000999947.1.39289 WP_000999947.1.39302 WP_000999947.1.39305 WP_000999947.1.39335 WP_000999947.1.39342 WP_000999947.1.39356 WP_000999947.1.39365 WP_000999947.1.39367 WP_000999947.1.39373 WP_000999947.1.39401 WP_000999947.1.39402 WP_000999947.1.39430 WP_000999947.1.39468 WP_000999947.1.39481 WP_000999947.1.39492 WP_000999947.1.39509 WP_000999947.1.39531 WP_000999947.1.3954 WP_000999947.1.39580 WP_000999947.1.39594 WP_000999947.1.39606 WP_000999947.1.39607 WP_000999947.1.39610 WP_000999947.1.39626 WP_000999947.1.39636 WP_000999947.1.39690 WP_000999947.1.3970 WP_000999947.1.39708 WP_000999947.1.39709 WP_000999947.1.39713 WP_000999947.1.39715 WP_000999947.1.39730 WP_000999947.1.39733 WP_000999947.1.39758 WP_000999947.1.39780 WP_000999947.1.3980 WP_000999947.1.39809 WP_000999947.1.39818 WP_000999947.1.39822 WP_000999947.1.39829 WP_000999947.1.39867 WP_000999947.1.39870 WP_000999947.1.39938 WP_000999947.1.39961 WP_000999947.1.39966 WP_000999947.1.39973 WP_000999947.1.39992 WP_000999947.1.39998 WP_000999947.1.40013 WP_000999947.1.40016 WP_000999947.1.4005 WP_000999947.1.40088 WP_000999947.1.40107 WP_000999947.1.40121 WP_000999947.1.40140 WP_000999947.1.40147 WP_000999947.1.40159 WP_000999947.1.40183 WP_000999947.1.40192 WP_000999947.1.4020 WP_000999947.1.40206 WP_000999947.1.40212 WP_000999947.1.40218 WP_000999947.1.40238 WP_000999947.1.40249 WP_000999947.1.40298 WP_000999947.1.40300 WP_000999947.1.40315 WP_000999947.1.40317 WP_000999947.1.40319 WP_000999947.1.40335 WP_000999947.1.40345 WP_000999947.1.40360 WP_000999947.1.40382 WP_000999947.1.40389 WP_000999947.1.40391 WP_000999947.1.40445 WP_000999947.1.4049 WP_000999947.1.40499 WP_000999947.1.40502 WP_000999947.1.40509 WP_000999947.1.40524 WP_000999947.1.40548 WP_000999947.1.40560 WP_000999947.1.40563 WP_000999947.1.40596 WP_000999947.1.40599 WP_000999947.1.406 WP_000999947.1.40617 WP_000999947.1.40623 WP_000999947.1.40636 WP_000999947.1.40657 WP_000999947.1.40660 WP_000999947.1.40666 WP_000999947.1.40668 WP_000999947.1.40686 WP_000999947.1.40712 WP_000999947.1.40715 WP_000999947.1.40781 WP_000999947.1.4081 WP_000999947.1.40813 WP_000999947.1.40815 WP_000999947.1.4082 WP_000999947.1.40833 WP_000999947.1.40865 WP_000999947.1.40893 WP_000999947.1.40898 WP_000999947.1.40912 WP_000999947.1.40937 WP_000999947.1.40965 WP_000999947.1.41037 WP_000999947.1.41045 WP_000999947.1.41125 WP_000999947.1.41147 WP_000999947.1.41206 WP_000999947.1.41230 WP_000999947.1.41239 WP_000999947.1.41244 WP_000999947.1.41259 WP_000999947.1.4126 WP_000999947.1.41263 WP_000999947.1.41287 WP_000999947.1.41315 WP_000999947.1.41346 WP_000999947.1.41363 WP_000999947.1.41368 WP_000999947.1.41371 WP_000999947.1.41392 WP_000999947.1.41401 WP_000999947.1.41402 WP_000999947.1.41407 WP_000999947.1.41417 WP_000999947.1.41436 WP_000999947.1.41453 WP_000999947.1.41455 WP_000999947.1.41457 WP_000999947.1.41466 WP_000999947.1.41479 WP_000999947.1.41482 WP_000999947.1.41483 WP_000999947.1.41484 WP_000999947.1.41488 WP_000999947.1.41530 WP_000999947.1.41545 WP_000999947.1.41556 WP_000999947.1.41566 WP_000999947.1.41606 WP_000999947.1.41613 WP_000999947.1.41621 WP_000999947.1.41651 WP_000999947.1.41654 WP_000999947.1.41712 WP_000999947.1.41718 WP_000999947.1.4172 WP_000999947.1.41740 WP_000999947.1.41741 WP_000999947.1.41752 WP_000999947.1.41778 WP_000999947.1.41780 WP_000999947.1.41782 WP_000999947.1.41783 WP_000999947.1.41784 WP_000999947.1.41809 WP_000999947.1.41812 WP_000999947.1.41813 WP_000999947.1.41826 WP_000999947.1.41837 WP_000999947.1.41885 WP_000999947.1.41900 WP_000999947.1.4193 WP_000999947.1.41956 WP_000999947.1.41964 WP_000999947.1.41988 WP_000999947.1.41990 WP_000999947.1.42022 WP_000999947.1.42033 WP_000999947.1.42038 WP_000999947.1.42060 WP_000999947.1.42073 WP_000999947.1.42095 WP_000999947.1.42096 WP_000999947.1.42113 WP_000999947.1.42138 WP_000999947.1.4214 WP_000999947.1.42151 WP_000999947.1.42159 WP_000999947.1.42179 WP_000999947.1.42203 WP_000999947.1.42209 WP_000999947.1.42214 WP_000999947.1.42221 WP_000999947.1.42226 WP_000999947.1.42233 WP_000999947.1.4224 WP_000999947.1.42252 WP_000999947.1.42277 WP_000999947.1.42284 WP_000999947.1.42300 WP_000999947.1.42318 WP_000999947.1.42359 WP_000999947.1.42367 WP_000999947.1.42369 WP_000999947.1.42376 WP_000999947.1.42387 WP_000999947.1.42415 WP_000999947.1.4242 WP_000999947.1.42432 WP_000999947.1.42442 WP_000999947.1.42443 WP_000999947.1.42456 WP_000999947.1.42480 WP_000999947.1.42516 WP_000999947.1.42522 WP_000999947.1.42547 WP_000999947.1.42601 WP_000999947.1.42632 WP_000999947.1.42638 WP_000999947.1.42661 WP_000999947.1.42669 WP_000999947.1.42728 WP_000999947.1.42748 WP_000999947.1.42750 WP_000999947.1.42756 WP_000999947.1.42761 WP_000999947.1.42770 WP_000999947.1.42771 WP_000999947.1.42791 WP_000999947.1.42808 WP_000999947.1.42813 WP_000999947.1.4282 WP_000999947.1.42828 WP_000999947.1.42830 WP_000999947.1.42832 WP_000999947.1.42879 WP_000999947.1.42891 WP_000999947.1.4290 WP_000999947.1.42918 WP_000999947.1.42936 WP_000999947.1.42937 WP_000999947.1.42950 WP_000999947.1.42962 WP_000999947.1.42966 WP_000999947.1.42987 WP_000999947.1.43035 WP_000999947.1.4306 WP_000999947.1.43123 WP_000999947.1.43132 WP_000999947.1.43137 WP_000999947.1.43166 WP_000999947.1.43174 WP_000999947.1.43177 WP_000999947.1.43213 WP_000999947.1.43239 WP_000999947.1.43270 WP_000999947.1.43278 WP_000999947.1.43316 WP_000999947.1.43324 WP_000999947.1.4334 WP_000999947.1.43374 WP_000999947.1.43389 WP_000999947.1.4342 WP_000999947.1.4343 WP_000999947.1.43455 WP_000999947.1.43473 WP_000999947.1.43474 WP_000999947.1.43489 WP_000999947.1.43501 WP_000999947.1.43566 WP_000999947.1.43598 WP_000999947.1.436 WP_000999947.1.43642 WP_000999947.1.43720 WP_000999947.1.43738 WP_000999947.1.43769 WP_000999947.1.43804 WP_000999947.1.43858 WP_000999947.1.43898 WP_000999947.1.43918 WP_000999947.1.43925 WP_000999947.1.43966 WP_000999947.1.4400 WP_000999947.1.44018 WP_000999947.1.44020 WP_000999947.1.44029 WP_000999947.1.44040 WP_000999947.1.44051 WP_000999947.1.44075 WP_000999947.1.44077 WP_000999947.1.44088 WP_000999947.1.44096 WP_000999947.1.44100 WP_000999947.1.4411 WP_000999947.1.44115 WP_000999947.1.4415 WP_000999947.1.44162 WP_000999947.1.44166 WP_000999947.1.44201 WP_000999947.1.44203 WP_000999947.1.44238 WP_000999947.1.44263 WP_000999947.1.44264 WP_000999947.1.44273 WP_000999947.1.44285 WP_000999947.1.44287 WP_000999947.1.44292 WP_000999947.1.44314 WP_000999947.1.44324 WP_000999947.1.44354 WP_000999947.1.44365 WP_000999947.1.44394 WP_000999947.1.44424 WP_000999947.1.44426 WP_000999947.1.44445 WP_000999947.1.44458 WP_000999947.1.44461 WP_000999947.1.4449 WP_000999947.1.44524 WP_000999947.1.44539 WP_000999947.1.4454 WP_000999947.1.44558 WP_000999947.1.44570 WP_000999947.1.44587 WP_000999947.1.44608 WP_000999947.1.44610 WP_000999947.1.4463 WP_000999947.1.44642 WP_000999947.1.44649 WP_000999947.1.44686 WP_000999947.1.4471 WP_000999947.1.44724 WP_000999947.1.4473 WP_000999947.1.44756 WP_000999947.1.448 WP_000999947.1.44814 WP_000999947.1.44818 WP_000999947.1.44821 WP_000999947.1.44841 WP_000999947.1.44848 WP_000999947.1.44849 WP_000999947.1.44855 WP_000999947.1.44857 WP_000999947.1.44923 WP_000999947.1.44960 WP_000999947.1.44961 WP_000999947.1.44970 WP_000999947.1.44977 WP_000999947.1.44980 WP_000999947.1.45043 WP_000999947.1.45053 WP_000999947.1.45068 WP_000999947.1.45104 WP_000999947.1.45156 WP_000999947.1.4516 WP_000999947.1.45208 WP_000999947.1.4524 WP_000999947.1.45246 WP_000999947.1.45301 WP_000999947.1.45329 WP_000999947.1.45359 WP_000999947.1.4538 WP_000999947.1.45404 WP_000999947.1.45405 WP_000999947.1.45440 WP_000999947.1.45444 WP_000999947.1.45486 WP_000999947.1.4549 WP_000999947.1.45494 WP_000999947.1.45500 WP_000999947.1.45565 WP_000999947.1.45581 WP_000999947.1.45595 WP_000999947.1.45600 WP_000999947.1.45627 WP_000999947.1.4563 WP_000999947.1.45664 WP_000999947.1.45676 WP_000999947.1.4570 WP_000999947.1.45718 WP_000999947.1.4574 WP_000999947.1.45740 WP_000999947.1.45806 WP_000999947.1.4583 WP_000999947.1.45840 WP_000999947.1.45846 WP_000999947.1.45865 WP_000999947.1.45868 WP_000999947.1.4593 WP_000999947.1.45930 WP_000999947.1.45931 WP_000999947.1.45933 WP_000999947.1.45945 WP_000999947.1.45960 WP_000999947.1.45962 WP_000999947.1.45968 WP_000999947.1.45991 WP_000999947.1.4600 WP_000999947.1.46026 WP_000999947.1.46027 WP_000999947.1.46048 WP_000999947.1.46049 WP_000999947.1.46070 WP_000999947.1.46081 WP_000999947.1.46097 WP_000999947.1.46105 WP_000999947.1.46115 WP_000999947.1.46122 WP_000999947.1.4613 WP_000999947.1.46164 WP_000999947.1.4617 WP_000999947.1.46186 WP_000999947.1.46197 WP_000999947.1.46213 WP_000999947.1.46217 WP_000999947.1.46239 WP_000999947.1.46245 WP_000999947.1.46257 WP_000999947.1.46291 WP_000999947.1.46301 WP_000999947.1.46325 WP_000999947.1.46329 WP_000999947.1.46379 WP_000999947.1.4643 WP_000999947.1.46433 WP_000999947.1.46441 WP_000999947.1.4646 WP_000999947.1.46468 WP_000999947.1.4647 WP_000999947.1.46477 WP_000999947.1.46487 WP_000999947.1.46526 WP_000999947.1.46531 WP_000999947.1.46541 WP_000999947.1.46552 WP_000999947.1.46555 WP_000999947.1.4657 WP_000999947.1.46582 WP_000999947.1.46594 WP_000999947.1.46602 WP_000999947.1.46614 WP_000999947.1.46616 WP_000999947.1.46655 WP_000999947.1.46668 WP_000999947.1.46734 WP_000999947.1.46743 WP_000999947.1.46802 WP_000999947.1.46806 WP_000999947.1.46820 WP_000999947.1.46821 WP_000999947.1.46841 WP_000999947.1.46857 WP_000999947.1.46860 WP_000999947.1.46876 WP_000999947.1.46882 WP_000999947.1.46898 WP_000999947.1.46909 WP_000999947.1.4691 WP_000999947.1.46912 WP_000999947.1.46932 WP_000999947.1.46990 WP_000999947.1.46999 WP_000999947.1.47028 WP_000999947.1.47030 WP_000999947.1.47034 WP_000999947.1.47038 WP_000999947.1.47048 WP_000999947.1.47050 WP_000999947.1.47063 WP_000999947.1.47069 WP_000999947.1.47073 WP_000999947.1.47156 WP_000999947.1.47197 WP_000999947.1.4722 WP_000999947.1.47224 WP_000999947.1.47246 WP_000999947.1.4725 WP_000999947.1.47280 WP_000999947.1.47307 WP_000999947.1.47316 WP_000999947.1.47319 WP_000999947.1.47332 WP_000999947.1.47350 WP_000999947.1.47356 WP_000999947.1.47363 WP_000999947.1.47370 WP_000999947.1.47386 WP_000999947.1.47398 WP_000999947.1.4740 WP_000999947.1.47414 WP_000999947.1.47416 WP_000999947.1.47425 WP_000999947.1.47451 WP_000999947.1.47464 WP_000999947.1.47473 WP_000999947.1.47477 WP_000999947.1.47496 WP_000999947.1.47529 WP_000999947.1.47546 WP_000999947.1.47555 WP_000999947.1.47582 WP_000999947.1.47634 WP_000999947.1.47646 WP_000999947.1.47654 WP_000999947.1.47662 WP_000999947.1.4772 WP_000999947.1.47722 WP_000999947.1.4773 WP_000999947.1.47734 WP_000999947.1.47740 WP_000999947.1.47744 WP_000999947.1.47761 WP_000999947.1.47765 WP_000999947.1.47770 WP_000999947.1.47790 WP_000999947.1.47791 WP_000999947.1.47820 WP_000999947.1.4783 WP_000999947.1.47848 WP_000999947.1.4785 WP_000999947.1.47914 WP_000999947.1.47935 WP_000999947.1.4796 WP_000999947.1.47962 WP_000999947.1.47976 WP_000999947.1.47981 WP_000999947.1.47983 WP_000999947.1.48000 WP_000999947.1.48018 WP_000999947.1.48029 WP_000999947.1.48040 WP_000999947.1.48048 WP_000999947.1.48051 WP_000999947.1.48073 WP_000999947.1.48077 WP_000999947.1.48087 WP_000999947.1.48096 WP_000999947.1.4811 WP_000999947.1.48111 WP_000999947.1.48144 WP_000999947.1.48168 WP_000999947.1.48194 WP_000999947.1.48200 WP_000999947.1.48203 WP_000999947.1.48222 WP_000999947.1.48229 WP_000999947.1.4826 WP_000999947.1.48285 WP_000999947.1.48290 WP_000999947.1.48291 WP_000999947.1.48317 WP_000999947.1.48353 WP_000999947.1.48355 WP_000999947.1.48371 WP_000999947.1.48404 WP_000999947.1.48417 WP_000999947.1.48421 WP_000999947.1.48433 WP_000999947.1.48469 WP_000999947.1.48480 WP_000999947.1.48483 WP_000999947.1.48505 WP_000999947.1.48522 WP_000999947.1.4857 WP_000999947.1.48571 WP_000999947.1.48590 WP_000999947.1.486 WP_000999947.1.48602 WP_000999947.1.48615 WP_000999947.1.48678 WP_000999947.1.48689 WP_000999947.1.4871 WP_000999947.1.4876 WP_000999947.1.48771 WP_000999947.1.48801 WP_000999947.1.48825 WP_000999947.1.48827 WP_000999947.1.48860 WP_000999947.1.48901 WP_000999947.1.48907 WP_000999947.1.48921 WP_000999947.1.48926 WP_000999947.1.48928 WP_000999947.1.48953 WP_000999947.1.48954 WP_000999947.1.48970 WP_000999947.1.48974 WP_000999947.1.49009 WP_000999947.1.49076 WP_000999947.1.49107 WP_000999947.1.49124 WP_000999947.1.49136 WP_000999947.1.49147 WP_000999947.1.49190 WP_000999947.1.49229 WP_000999947.1.49243 WP_000999947.1.49258 WP_000999947.1.49259 WP_000999947.1.49275 WP_000999947.1.49312 WP_000999947.1.49321 WP_000999947.1.49336 WP_000999947.1.49347 WP_000999947.1.49431 WP_000999947.1.49459 WP_000999947.1.49481 WP_000999947.1.49482 WP_000999947.1.4949 WP_000999947.1.49521 WP_000999947.1.49528 WP_000999947.1.49531 WP_000999947.1.49537 WP_000999947.1.49546 WP_000999947.1.49558 WP_000999947.1.49594 WP_000999947.1.49599 WP_000999947.1.49615 WP_000999947.1.49621 WP_000999947.1.49625 WP_000999947.1.49645 WP_000999947.1.49661 WP_000999947.1.49684 WP_000999947.1.497 WP_000999947.1.49712 WP_000999947.1.49722 WP_000999947.1.49733 WP_000999947.1.49740 WP_000999947.1.49747 WP_000999947.1.49768 WP_000999947.1.49774 WP_000999947.1.49777 WP_000999947.1.49783 WP_000999947.1.49856 WP_000999947.1.49861 WP_000999947.1.49879 WP_000999947.1.49884 WP_000999947.1.49900 WP_000999947.1.49902 WP_000999947.1.49950 WP_000999947.1.49954 WP_000999947.1.49972 WP_000999947.1.49987 WP_000999947.1.50006 WP_000999947.1.50008 WP_000999947.1.50036 WP_000999947.1.50058 WP_000999947.1.50078 WP_000999947.1.50098 WP_000999947.1.50113 WP_000999947.1.50119 WP_000999947.1.50136 WP_000999947.1.5017 WP_000999947.1.50179 WP_000999947.1.50182 WP_000999947.1.50187 WP_000999947.1.50191 WP_000999947.1.50196 WP_000999947.1.50207 WP_000999947.1.50230 WP_000999947.1.50258 WP_000999947.1.50262 WP_000999947.1.50269 WP_000999947.1.50273 WP_000999947.1.50304 WP_000999947.1.50329 WP_000999947.1.50353 WP_000999947.1.50361 WP_000999947.1.50366 WP_000999947.1.50381 WP_000999947.1.5040 WP_000999947.1.5041 WP_000999947.1.50412 WP_000999947.1.50418 WP_000999947.1.50427 WP_000999947.1.50446 WP_000999947.1.50452 WP_000999947.1.5046 WP_000999947.1.50539 WP_000999947.1.50548 WP_000999947.1.5056 WP_000999947.1.50579 WP_000999947.1.50585 WP_000999947.1.506 WP_000999947.1.50616 WP_000999947.1.5064 WP_000999947.1.5067 WP_000999947.1.50690 WP_000999947.1.50715 WP_000999947.1.50725 WP_000999947.1.50728 WP_000999947.1.50925 WP_000999947.1.50936 WP_000999947.1.50939 WP_000999947.1.5095 WP_000999947.1.50969 WP_000999947.1.50988 WP_000999947.1.50990 WP_000999947.1.50993 WP_000999947.1.50996 WP_000999947.1.51013 WP_000999947.1.51027 WP_000999947.1.51042 WP_000999947.1.51109 WP_000999947.1.51127 WP_000999947.1.51170 WP_000999947.1.51172 WP_000999947.1.51175 WP_000999947.1.51180 WP_000999947.1.51190 WP_000999947.1.51201 WP_000999947.1.51211 WP_000999947.1.5124 WP_000999947.1.51248 WP_000999947.1.51253 WP_000999947.1.51260 WP_000999947.1.51278 WP_000999947.1.5128 WP_000999947.1.51283 WP_000999947.1.51299 WP_000999947.1.51300 WP_000999947.1.51320 WP_000999947.1.51323 WP_000999947.1.51325 WP_000999947.1.51330 WP_000999947.1.51336 WP_000999947.1.51354 WP_000999947.1.51360 WP_000999947.1.51364 WP_000999947.1.51392 WP_000999947.1.51405 WP_000999947.1.51425 WP_000999947.1.51427 WP_000999947.1.51430 WP_000999947.1.51441 WP_000999947.1.5146 WP_000999947.1.51462 WP_000999947.1.51482 WP_000999947.1.51490 WP_000999947.1.51495 WP_000999947.1.51503 WP_000999947.1.51513 WP_000999947.1.51525 WP_000999947.1.5153 WP_000999947.1.51537 WP_000999947.1.51539 WP_000999947.1.51542 WP_000999947.1.51552 WP_000999947.1.5157 WP_000999947.1.51580 WP_000999947.1.51587 WP_000999947.1.51596 WP_000999947.1.51607 WP_000999947.1.51624 WP_000999947.1.51629 WP_000999947.1.51662 WP_000999947.1.51707 WP_000999947.1.5172 WP_000999947.1.51760 WP_000999947.1.51784 WP_000999947.1.51837 WP_000999947.1.51839 WP_000999947.1.51869 WP_000999947.1.51873 WP_000999947.1.51899 WP_000999947.1.51906 WP_000999947.1.51968 WP_000999947.1.51979 WP_000999947.1.51985 WP_000999947.1.51988 WP_000999947.1.51999 WP_000999947.1.52002 WP_000999947.1.52011 WP_000999947.1.52020 WP_000999947.1.52044 WP_000999947.1.52048 WP_000999947.1.52076 WP_000999947.1.52098 WP_000999947.1.52111 WP_000999947.1.52126 WP_000999947.1.52127 WP_000999947.1.52171 WP_000999947.1.52186 WP_000999947.1.52200 WP_000999947.1.52211 WP_000999947.1.52213 WP_000999947.1.52214 WP_000999947.1.52225 WP_000999947.1.52230 WP_000999947.1.52236 WP_000999947.1.52240 WP_000999947.1.52243 WP_000999947.1.52249 WP_000999947.1.52257 WP_000999947.1.52258 WP_000999947.1.5227 WP_000999947.1.52270 WP_000999947.1.52271 WP_000999947.1.52272 WP_000999947.1.52304 WP_000999947.1.52305 WP_000999947.1.52324 WP_000999947.1.52328 WP_000999947.1.52333 WP_000999947.1.52378 WP_000999947.1.5239 WP_000999947.1.52399 WP_000999947.1.52413 WP_000999947.1.52419 WP_000999947.1.52492 WP_000999947.1.52524 WP_000999947.1.52544 WP_000999947.1.52554 WP_000999947.1.52558 WP_000999947.1.52567 WP_000999947.1.52568 WP_000999947.1.52601 WP_000999947.1.52612 WP_000999947.1.5265 WP_000999947.1.52662 WP_000999947.1.52691 WP_000999947.1.52710 WP_000999947.1.52735 WP_000999947.1.52755 WP_000999947.1.52762 WP_000999947.1.52771 WP_000999947.1.52774 WP_000999947.1.52777 WP_000999947.1.52781 WP_000999947.1.52844 WP_000999947.1.52846 WP_000999947.1.52852 WP_000999947.1.52853 WP_000999947.1.52855 WP_000999947.1.52881 WP_000999947.1.52895 WP_000999947.1.52908 WP_000999947.1.52913 WP_000999947.1.52942 WP_000999947.1.52945 WP_000999947.1.52962 WP_000999947.1.52995 WP_000999947.1.52996 WP_000999947.1.53012 WP_000999947.1.53020 WP_000999947.1.53027 WP_000999947.1.53095 WP_000999947.1.53099 WP_000999947.1.5310 WP_000999947.1.53110 WP_000999947.1.53155 WP_000999947.1.53186 WP_000999947.1.532 WP_000999947.1.5322 WP_000999947.1.53223 WP_000999947.1.53228 WP_000999947.1.53238 WP_000999947.1.53242 WP_000999947.1.53244 WP_000999947.1.53251 WP_000999947.1.53262 WP_000999947.1.53277 WP_000999947.1.53308 WP_000999947.1.53327 WP_000999947.1.53356 WP_000999947.1.53360 WP_000999947.1.53364 WP_000999947.1.53377 WP_000999947.1.53401 WP_000999947.1.53419 WP_000999947.1.5342 WP_000999947.1.53428 WP_000999947.1.53431 WP_000999947.1.53505 WP_000999947.1.5351 WP_000999947.1.53535 WP_000999947.1.53537 WP_000999947.1.53545 WP_000999947.1.53574 WP_000999947.1.53582 WP_000999947.1.53589 WP_000999947.1.53590 WP_000999947.1.53592 WP_000999947.1.53594 WP_000999947.1.5362 WP_000999947.1.53642 WP_000999947.1.53645 WP_000999947.1.53706 WP_000999947.1.53769 WP_000999947.1.53809 WP_000999947.1.53811 WP_000999947.1.53841 WP_000999947.1.53863 WP_000999947.1.53866 WP_000999947.1.53878 WP_000999947.1.53884 WP_000999947.1.5391 WP_000999947.1.53931 WP_000999947.1.5395 WP_000999947.1.53966 WP_000999947.1.53968 WP_000999947.1.53972 WP_000999947.1.53978 WP_000999947.1.53991 WP_000999947.1.53994 WP_000999947.1.54002 WP_000999947.1.54013 WP_000999947.1.54023 WP_000999947.1.54028 WP_000999947.1.54072 WP_000999947.1.54091 WP_000999947.1.54095 WP_000999947.1.54144 WP_000999947.1.54169 WP_000999947.1.54185 WP_000999947.1.54202 WP_000999947.1.54263 WP_000999947.1.54307 WP_000999947.1.54317 WP_000999947.1.54328 WP_000999947.1.54329 WP_000999947.1.5433 WP_000999947.1.54344 WP_000999947.1.54359 WP_000999947.1.5440 WP_000999947.1.54411 WP_000999947.1.54418 WP_000999947.1.54429 WP_000999947.1.54439 WP_000999947.1.54463 WP_000999947.1.54507 WP_000999947.1.54546 WP_000999947.1.54591 WP_000999947.1.5460 WP_000999947.1.54601 WP_000999947.1.54602 WP_000999947.1.54605 WP_000999947.1.5461 WP_000999947.1.54614 WP_000999947.1.54617 WP_000999947.1.54620 WP_000999947.1.54638 WP_000999947.1.54641 WP_000999947.1.54643 WP_000999947.1.54688 WP_000999947.1.54695 WP_000999947.1.5470 WP_000999947.1.54708 WP_000999947.1.54725 WP_000999947.1.54729 WP_000999947.1.54760 WP_000999947.1.54769 WP_000999947.1.5479 WP_000999947.1.54798 WP_000999947.1.54829 WP_000999947.1.5486 WP_000999947.1.54918 WP_000999947.1.54921 WP_000999947.1.54927 WP_000999947.1.54941 WP_000999947.1.54946 WP_000999947.1.54972 WP_000999947.1.54981 WP_000999947.1.54991 WP_000999947.1.55003 WP_000999947.1.55005 WP_000999947.1.55009 WP_000999947.1.55041 WP_000999947.1.55112 WP_000999947.1.55123 WP_000999947.1.55134 WP_000999947.1.55144 WP_000999947.1.55149 WP_000999947.1.55151 WP_000999947.1.55177 WP_000999947.1.55197 WP_000999947.1.5520 WP_000999947.1.55203 WP_000999947.1.55222 WP_000999947.1.55226 WP_000999947.1.55286 WP_000999947.1.55291 WP_000999947.1.55342 WP_000999947.1.55357 WP_000999947.1.55359 WP_000999947.1.55374 WP_000999947.1.55381 WP_000999947.1.55417 WP_000999947.1.55424 WP_000999947.1.55425 WP_000999947.1.5546 WP_000999947.1.55466 WP_000999947.1.55482 WP_000999947.1.55483 WP_000999947.1.55489 WP_000999947.1.55492 WP_000999947.1.55507 WP_000999947.1.55529 WP_000999947.1.55551 WP_000999947.1.55552 WP_000999947.1.55556 WP_000999947.1.55560 WP_000999947.1.55571 WP_000999947.1.55574 WP_000999947.1.55581 WP_000999947.1.55597 WP_000999947.1.55608 WP_000999947.1.5561 WP_000999947.1.55629 WP_000999947.1.5566 WP_000999947.1.55676 WP_000999947.1.5570 WP_000999947.1.55709 WP_000999947.1.55720 WP_000999947.1.55727 WP_000999947.1.55757 WP_000999947.1.55787 WP_000999947.1.55825 WP_000999947.1.55844 WP_000999947.1.55868 WP_000999947.1.55979 WP_000999947.1.55981 WP_000999947.1.55988 WP_000999947.1.56033 WP_000999947.1.56040 WP_000999947.1.561 WP_000999947.1.56101 WP_000999947.1.56139 WP_000999947.1.5614 WP_000999947.1.56142 WP_000999947.1.56149 WP_000999947.1.5616 WP_000999947.1.56164 WP_000999947.1.56169 WP_000999947.1.56177 WP_000999947.1.56193 WP_000999947.1.56216 WP_000999947.1.56231 WP_000999947.1.56278 WP_000999947.1.56293 WP_000999947.1.56302 WP_000999947.1.5632 WP_000999947.1.56338 WP_000999947.1.56345 WP_000999947.1.56371 WP_000999947.1.56388 WP_000999947.1.56390 WP_000999947.1.56399 WP_000999947.1.56402 WP_000999947.1.56439 WP_000999947.1.56446 WP_000999947.1.56457 WP_000999947.1.5646 WP_000999947.1.5649 WP_000999947.1.56502 WP_000999947.1.56513 WP_000999947.1.56528 WP_000999947.1.56543 WP_000999947.1.56573 WP_000999947.1.56586 WP_000999947.1.56665 WP_000999947.1.56680 WP_000999947.1.56689 WP_000999947.1.5670 WP_000999947.1.56704 WP_000999947.1.56713 WP_000999947.1.56721 WP_000999947.1.56776 WP_000999947.1.56777 WP_000999947.1.56786 WP_000999947.1.56787 WP_000999947.1.56789 WP_000999947.1.56799 WP_000999947.1.56821 WP_000999947.1.56830 WP_000999947.1.56835 WP_000999947.1.56846 WP_000999947.1.5685 WP_000999947.1.56871 WP_000999947.1.56882 WP_000999947.1.56908 WP_000999947.1.56932 WP_000999947.1.56933 WP_000999947.1.56934 WP_000999947.1.56936 WP_000999947.1.56937 WP_000999947.1.56951 WP_000999947.1.56978 WP_000999947.1.56992 WP_000999947.1.57051 WP_000999947.1.57068 WP_000999947.1.57086 WP_000999947.1.57100 WP_000999947.1.57124 WP_000999947.1.57159 WP_000999947.1.57181 WP_000999947.1.57182 WP_000999947.1.57185 WP_000999947.1.57216 WP_000999947.1.57222 WP_000999947.1.57254 WP_000999947.1.57266 WP_000999947.1.57269 WP_000999947.1.57281 WP_000999947.1.57319 WP_000999947.1.57386 WP_000999947.1.57401 WP_000999947.1.57403 WP_000999947.1.57410 WP_000999947.1.57414 WP_000999947.1.5742 WP_000999947.1.57432 WP_000999947.1.57451 WP_000999947.1.5748 WP_000999947.1.57487 WP_000999947.1.57517 WP_000999947.1.57538 WP_000999947.1.5755 WP_000999947.1.57558 WP_000999947.1.57574 WP_000999947.1.57588 WP_000999947.1.57628 WP_000999947.1.57629 WP_000999947.1.57634 WP_000999947.1.57638 WP_000999947.1.57659 WP_000999947.1.57663 WP_000999947.1.57669 WP_000999947.1.57719 WP_000999947.1.57738 WP_000999947.1.57812 WP_000999947.1.57846 WP_000999947.1.5786 WP_000999947.1.57898 WP_000999947.1.57903 WP_000999947.1.57904 WP_000999947.1.57920 WP_000999947.1.57951 WP_000999947.1.57975 WP_000999947.1.57982 WP_000999947.1.57983 WP_000999947.1.57994 WP_000999947.1.58001 WP_000999947.1.58022 WP_000999947.1.58045 WP_000999947.1.58060 WP_000999947.1.58080 WP_000999947.1.58092 WP_000999947.1.58094 WP_000999947.1.58097 WP_000999947.1.58098 WP_000999947.1.5810 WP_000999947.1.5812 WP_000999947.1.58128 WP_000999947.1.58143 WP_000999947.1.58146 WP_000999947.1.58163 WP_000999947.1.58172 WP_000999947.1.58206 WP_000999947.1.58226 WP_000999947.1.58232 WP_000999947.1.58244 WP_000999947.1.58248 WP_000999947.1.58267 WP_000999947.1.58289 WP_000999947.1.58316 WP_000999947.1.58336 WP_000999947.1.58340 WP_000999947.1.58368 WP_000999947.1.58371 WP_000999947.1.58384 WP_000999947.1.58401 WP_000999947.1.58408 WP_000999947.1.5842 WP_000999947.1.58420 WP_000999947.1.58429 WP_000999947.1.58440 WP_000999947.1.58445 WP_000999947.1.58484 WP_000999947.1.58496 WP_000999947.1.58507 WP_000999947.1.58514 WP_000999947.1.58528 WP_000999947.1.58547 WP_000999947.1.58552 WP_000999947.1.58560 WP_000999947.1.58572 WP_000999947.1.58582 WP_000999947.1.58609 WP_000999947.1.58617 WP_000999947.1.58622 WP_000999947.1.58680 WP_000999947.1.58705 WP_000999947.1.58799 WP_000999947.1.58837 WP_000999947.1.58867 WP_000999947.1.58901 WP_000999947.1.58940 WP_000999947.1.58942 WP_000999947.1.58951 WP_000999947.1.58958 WP_000999947.1.58976 WP_000999947.1.58977 WP_000999947.1.58983 WP_000999947.1.58999 WP_000999947.1.59024 WP_000999947.1.59035 WP_000999947.1.59047 WP_000999947.1.5906 WP_000999947.1.59073 WP_000999947.1.59083 WP_000999947.1.59119 WP_000999947.1.59174 WP_000999947.1.59190 WP_000999947.1.59199 WP_000999947.1.59218 WP_000999947.1.59280 WP_000999947.1.59293 WP_000999947.1.59302 WP_000999947.1.59306 WP_000999947.1.59395 WP_000999947.1.59396 WP_000999947.1.59407 WP_000999947.1.59413 WP_000999947.1.5942 WP_000999947.1.59423 WP_000999947.1.59426 WP_000999947.1.59434 WP_000999947.1.59533 WP_000999947.1.59553 WP_000999947.1.59572 WP_000999947.1.59590 WP_000999947.1.59615 WP_000999947.1.59621 WP_000999947.1.5963 WP_000999947.1.59638 WP_000999947.1.5965 WP_000999947.1.59660 WP_000999947.1.59689 WP_000999947.1.59699 WP_000999947.1.597 WP_000999947.1.59717 WP_000999947.1.59730 WP_000999947.1.59737 WP_000999947.1.59745 WP_000999947.1.59748 WP_000999947.1.59756 WP_000999947.1.59781 WP_000999947.1.59782 WP_000999947.1.59788 WP_000999947.1.59791 WP_000999947.1.59823 WP_000999947.1.59836 WP_000999947.1.59853 WP_000999947.1.59855 WP_000999947.1.59858 WP_000999947.1.59877 WP_000999947.1.5990 WP_000999947.1.59914 WP_000999947.1.59932 WP_000999947.1.59998 WP_000999947.1.60005 WP_000999947.1.6002 WP_000999947.1.60023 WP_000999947.1.60031 WP_000999947.1.60067 WP_000999947.1.60070 WP_000999947.1.60095 WP_000999947.1.6013 WP_000999947.1.60133 WP_000999947.1.60186 WP_000999947.1.6022 WP_000999947.1.60225 WP_000999947.1.60228 WP_000999947.1.60235 WP_000999947.1.60246 WP_000999947.1.60325 WP_000999947.1.60337 WP_000999947.1.60343 WP_000999947.1.60373 WP_000999947.1.60387 WP_000999947.1.60436 WP_000999947.1.60443 WP_000999947.1.60457 WP_000999947.1.60477 WP_000999947.1.60491 WP_000999947.1.60498 WP_000999947.1.60505 WP_000999947.1.60544 WP_000999947.1.60550 WP_000999947.1.60555 WP_000999947.1.60559 WP_000999947.1.60567 WP_000999947.1.60570 WP_000999947.1.60576 WP_000999947.1.6059 WP_000999947.1.60599 WP_000999947.1.60606 WP_000999947.1.6061 WP_000999947.1.60614 WP_000999947.1.6064 WP_000999947.1.60644 WP_000999947.1.6066 WP_000999947.1.60671 WP_000999947.1.6068 WP_000999947.1.60684 WP_000999947.1.60698 WP_000999947.1.60717 WP_000999947.1.60732 WP_000999947.1.60764 WP_000999947.1.60771 WP_000999947.1.60805 WP_000999947.1.60816 WP_000999947.1.60826 WP_000999947.1.60832 WP_000999947.1.60835 WP_000999947.1.60847 WP_000999947.1.60895 WP_000999947.1.60901 WP_000999947.1.60921 WP_000999947.1.60925 WP_000999947.1.60927 WP_000999947.1.60935 WP_000999947.1.6094 WP_000999947.1.60974 WP_000999947.1.61005 WP_000999947.1.61006 WP_000999947.1.61008 WP_000999947.1.61035 WP_000999947.1.61046 WP_000999947.1.61058 WP_000999947.1.61096 WP_000999947.1.61097 WP_000999947.1.6110 WP_000999947.1.61102 WP_000999947.1.61112 WP_000999947.1.61132 WP_000999947.1.61148 WP_000999947.1.61170 WP_000999947.1.61174 WP_000999947.1.61175 WP_000999947.1.61183 WP_000999947.1.61223 WP_000999947.1.61225 WP_000999947.1.61245 WP_000999947.1.61268 WP_000999947.1.61284 WP_000999947.1.61292 WP_000999947.1.61362 WP_000999947.1.61364 WP_000999947.1.61373 WP_000999947.1.61398 WP_000999947.1.61445 WP_000999947.1.61496 WP_000999947.1.61505 WP_000999947.1.61512 WP_000999947.1.61517 WP_000999947.1.61524 WP_000999947.1.61551 WP_000999947.1.61608 WP_000999947.1.61612 WP_000999947.1.61636 WP_000999947.1.61643 WP_000999947.1.61663 WP_000999947.1.61703 WP_000999947.1.61718 WP_000999947.1.61758 WP_000999947.1.61770 WP_000999947.1.61772 WP_000999947.1.61779 WP_000999947.1.61806 WP_000999947.1.61822 WP_000999947.1.61853 WP_000999947.1.61893 WP_000999947.1.61926 WP_000999947.1.61939 WP_000999947.1.61948 WP_000999947.1.61949 WP_000999947.1.61955 WP_000999947.1.61957 WP_000999947.1.61966 WP_000999947.1.61985 WP_000999947.1.62041 WP_000999947.1.62099 WP_000999947.1.62102 WP_000999947.1.6212 WP_000999947.1.62157 WP_000999947.1.62207 WP_000999947.1.62264 WP_000999947.1.62273 WP_000999947.1.62290 WP_000999947.1.62296 WP_000999947.1.62303 WP_000999947.1.62337 WP_000999947.1.62348 WP_000999947.1.62358 WP_000999947.1.62424 WP_000999947.1.62447 WP_000999947.1.6245 WP_000999947.1.62454 WP_000999947.1.62460 WP_000999947.1.62487 WP_000999947.1.62503 WP_000999947.1.62507 WP_000999947.1.62513 WP_000999947.1.62514 WP_000999947.1.62529 WP_000999947.1.62541 WP_000999947.1.62612 WP_000999947.1.62631 WP_000999947.1.62642 WP_000999947.1.62646 WP_000999947.1.62668 WP_000999947.1.62681 WP_000999947.1.62735 WP_000999947.1.62750 WP_000999947.1.62762 WP_000999947.1.62769 WP_000999947.1.62788 WP_000999947.1.62802 WP_000999947.1.62812 WP_000999947.1.62818 WP_000999947.1.62840 WP_000999947.1.62850 WP_000999947.1.62851 WP_000999947.1.62914 WP_000999947.1.62919 WP_000999947.1.6293 WP_000999947.1.62931 WP_000999947.1.62959 WP_000999947.1.62973 WP_000999947.1.62989 WP_000999947.1.6299 WP_000999947.1.62992 WP_000999947.1.63023 WP_000999947.1.6307 WP_000999947.1.63113 WP_000999947.1.63167 WP_000999947.1.63177 WP_000999947.1.63189 WP_000999947.1.63246 WP_000999947.1.63287 WP_000999947.1.63330 WP_000999947.1.6334 WP_000999947.1.6337 WP_000999947.1.63370 WP_000999947.1.63374 WP_000999947.1.63393 WP_000999947.1.63437 WP_000999947.1.63453 WP_000999947.1.63466 WP_000999947.1.63467 WP_000999947.1.63470 WP_000999947.1.63478 WP_000999947.1.6348 WP_000999947.1.63484 WP_000999947.1.63487 WP_000999947.1.63491 WP_000999947.1.63496 WP_000999947.1.63536 WP_000999947.1.63556 WP_000999947.1.63576 WP_000999947.1.63602 WP_000999947.1.63604 WP_000999947.1.63608 WP_000999947.1.63666 WP_000999947.1.63679 WP_000999947.1.63683 WP_000999947.1.63703 WP_000999947.1.63800 WP_000999947.1.63810 WP_000999947.1.63821 WP_000999947.1.63856 WP_000999947.1.63871 WP_000999947.1.63944 WP_000999947.1.63964 WP_000999947.1.63969 WP_000999947.1.63990 WP_000999947.1.64008 WP_000999947.1.64014 WP_000999947.1.64040 WP_000999947.1.64045 WP_000999947.1.64050 WP_000999947.1.64053 WP_000999947.1.64074 WP_000999947.1.64080 WP_000999947.1.64110 WP_000999947.1.64150 WP_000999947.1.6416 WP_000999947.1.64165 WP_000999947.1.64175 WP_000999947.1.64193 WP_000999947.1.64280 WP_000999947.1.64285 WP_000999947.1.64286 WP_000999947.1.6431 WP_000999947.1.64321 WP_000999947.1.64330 WP_000999947.1.64337 WP_000999947.1.64355 WP_000999947.1.64356 WP_000999947.1.64380 WP_000999947.1.64391 WP_000999947.1.6441 WP_000999947.1.64417 WP_000999947.1.64437 WP_000999947.1.64438 WP_000999947.1.64448 WP_000999947.1.64458 WP_000999947.1.64519 WP_000999947.1.64528 WP_000999947.1.64540 WP_000999947.1.64563 WP_000999947.1.64634 WP_000999947.1.64657 WP_000999947.1.6469 WP_000999947.1.64693 WP_000999947.1.64695 WP_000999947.1.647 WP_000999947.1.64707 WP_000999947.1.64746 WP_000999947.1.64789 WP_000999947.1.64821 WP_000999947.1.64866 WP_000999947.1.64881 WP_000999947.1.64895 WP_000999947.1.64901 WP_000999947.1.64912 WP_000999947.1.64926 WP_000999947.1.64939 WP_000999947.1.64970 WP_000999947.1.64990 WP_000999947.1.65023 WP_000999947.1.65040 WP_000999947.1.65061 WP_000999947.1.65085 WP_000999947.1.65097 WP_000999947.1.651 WP_000999947.1.6511 WP_000999947.1.65110 WP_000999947.1.65114 WP_000999947.1.65135 WP_000999947.1.65151 WP_000999947.1.65155 WP_000999947.1.6516 WP_000999947.1.65179 WP_000999947.1.65192 WP_000999947.1.65206 WP_000999947.1.65256 WP_000999947.1.65271 WP_000999947.1.65286 WP_000999947.1.65296 WP_000999947.1.65305 WP_000999947.1.65306 WP_000999947.1.65353 WP_000999947.1.65364 WP_000999947.1.6537 WP_000999947.1.65370 WP_000999947.1.654 WP_000999947.1.65408 WP_000999947.1.65413 WP_000999947.1.65415 WP_000999947.1.65456 WP_000999947.1.65493 WP_000999947.1.6553 WP_000999947.1.65531 WP_000999947.1.65581 WP_000999947.1.65596 WP_000999947.1.65606 WP_000999947.1.6563 WP_000999947.1.65667 WP_000999947.1.65672 WP_000999947.1.65677 WP_000999947.1.65708 WP_000999947.1.65714 WP_000999947.1.65762 WP_000999947.1.65912 WP_000999947.1.65954 WP_000999947.1.65961 WP_000999947.1.65962 WP_000999947.1.65976 WP_000999947.1.6599 WP_000999947.1.66001 WP_000999947.1.66007 WP_000999947.1.66017 WP_000999947.1.66022 WP_000999947.1.6604 WP_000999947.1.66044 WP_000999947.1.66050 WP_000999947.1.6609 WP_000999947.1.66102 WP_000999947.1.66104 WP_000999947.1.66105 WP_000999947.1.66121 WP_000999947.1.66161 WP_000999947.1.6618 WP_000999947.1.66187 WP_000999947.1.66197 WP_000999947.1.6622 WP_000999947.1.66251 WP_000999947.1.66264 WP_000999947.1.66288 WP_000999947.1.66290 WP_000999947.1.66327 WP_000999947.1.66335 WP_000999947.1.6635 WP_000999947.1.66376 WP_000999947.1.66387 WP_000999947.1.66389 WP_000999947.1.66395 WP_000999947.1.66412 WP_000999947.1.66432 WP_000999947.1.66448 WP_000999947.1.6645 WP_000999947.1.66501 WP_000999947.1.6654 WP_000999947.1.66550 WP_000999947.1.66559 WP_000999947.1.66579 WP_000999947.1.66624 WP_000999947.1.66644 WP_000999947.1.6665 WP_000999947.1.66700 WP_000999947.1.66719 WP_000999947.1.66751 WP_000999947.1.66758 WP_000999947.1.66783 WP_000999947.1.66791 WP_000999947.1.66794 WP_000999947.1.66795 WP_000999947.1.66796 WP_000999947.1.66849 WP_000999947.1.66926 WP_000999947.1.66933 WP_000999947.1.66948 WP_000999947.1.66975 WP_000999947.1.6698 WP_000999947.1.67018 WP_000999947.1.67022 WP_000999947.1.67026 WP_000999947.1.67029 WP_000999947.1.67035 WP_000999947.1.67102 WP_000999947.1.67116 WP_000999947.1.67120 WP_000999947.1.67137 WP_000999947.1.67149 WP_000999947.1.67153 WP_000999947.1.67158 WP_000999947.1.67174 WP_000999947.1.67193 WP_000999947.1.67194 WP_000999947.1.67210 WP_000999947.1.6723 WP_000999947.1.67258 WP_000999947.1.67272 WP_000999947.1.67293 WP_000999947.1.6735 WP_000999947.1.67383 WP_000999947.1.67415 WP_000999947.1.67427 WP_000999947.1.67451 WP_000999947.1.67452 WP_000999947.1.67454 WP_000999947.1.67456 WP_000999947.1.67462 WP_000999947.1.67464 WP_000999947.1.67467 WP_000999947.1.67468 WP_000999947.1.67522 WP_000999947.1.67538 WP_000999947.1.67549 WP_000999947.1.67553 WP_000999947.1.67581 WP_000999947.1.67590 WP_000999947.1.67606 WP_000999947.1.67663 WP_000999947.1.67681 WP_000999947.1.67685 WP_000999947.1.67701 WP_000999947.1.67704 WP_000999947.1.67724 WP_000999947.1.67732 WP_000999947.1.67737 WP_000999947.1.67786 WP_000999947.1.67787 WP_000999947.1.67788 WP_000999947.1.678 WP_000999947.1.67810 WP_000999947.1.67841 WP_000999947.1.67853 WP_000999947.1.67861 WP_000999947.1.67901 WP_000999947.1.67938 WP_000999947.1.67971 WP_000999947.1.67975 WP_000999947.1.67984 WP_000999947.1.67990 WP_000999947.1.67992 WP_000999947.1.67999 WP_000999947.1.68008 WP_000999947.1.68011 WP_000999947.1.68012 WP_000999947.1.6802 WP_000999947.1.68025 WP_000999947.1.6803 WP_000999947.1.68039 WP_000999947.1.68053 WP_000999947.1.68069 WP_000999947.1.68079 WP_000999947.1.6810 WP_000999947.1.68108 WP_000999947.1.68126 WP_000999947.1.6814 WP_000999947.1.68145 WP_000999947.1.68175 WP_000999947.1.68177 WP_000999947.1.682 WP_000999947.1.68200 WP_000999947.1.68215 WP_000999947.1.68241 WP_000999947.1.68255 WP_000999947.1.68278 WP_000999947.1.68281 WP_000999947.1.68283 WP_000999947.1.68300 WP_000999947.1.68336 WP_000999947.1.68341 WP_000999947.1.68347 WP_000999947.1.68362 WP_000999947.1.68369 WP_000999947.1.68395 WP_000999947.1.68442 WP_000999947.1.68482 WP_000999947.1.68490 WP_000999947.1.68524 WP_000999947.1.68534 WP_000999947.1.68566 WP_000999947.1.68572 WP_000999947.1.68584 WP_000999947.1.6860 WP_000999947.1.68609 WP_000999947.1.68630 WP_000999947.1.68635 WP_000999947.1.68673 WP_000999947.1.68678 WP_000999947.1.68679 WP_000999947.1.68695 WP_000999947.1.68697 WP_000999947.1.68711 WP_000999947.1.68750 WP_000999947.1.68751 WP_000999947.1.68752 WP_000999947.1.6877 WP_000999947.1.68795 WP_000999947.1.68797 WP_000999947.1.68801 WP_000999947.1.68865 WP_000999947.1.68880 WP_000999947.1.68915 WP_000999947.1.68924 WP_000999947.1.68956 WP_000999947.1.68961 WP_000999947.1.68989 WP_000999947.1.68995 WP_000999947.1.69033 WP_000999947.1.69039 WP_000999947.1.69098 WP_000999947.1.69126 WP_000999947.1.69127 WP_000999947.1.69144 WP_000999947.1.6916 WP_000999947.1.6919 WP_000999947.1.69192 WP_000999947.1.69221 WP_000999947.1.69247 WP_000999947.1.69258 WP_000999947.1.69261 WP_000999947.1.6929 WP_000999947.1.69303 WP_000999947.1.69305 WP_000999947.1.69390 WP_000999947.1.694 WP_000999947.1.69441 WP_000999947.1.69472 WP_000999947.1.69473 WP_000999947.1.69537 WP_000999947.1.69551 WP_000999947.1.69583 WP_000999947.1.69589 WP_000999947.1.69593 WP_000999947.1.69596 WP_000999947.1.69605 WP_000999947.1.69643 WP_000999947.1.69646 WP_000999947.1.69655 WP_000999947.1.69689 WP_000999947.1.69716 WP_000999947.1.69730 WP_000999947.1.69786 WP_000999947.1.69803 WP_000999947.1.69887 WP_000999947.1.69972 WP_000999947.1.69979 WP_000999947.1.7001 WP_000999947.1.70041 WP_000999947.1.70063 WP_000999947.1.70081 WP_000999947.1.7013 WP_000999947.1.70149 WP_000999947.1.70190 WP_000999947.1.70200 WP_000999947.1.70213 WP_000999947.1.70357 WP_000999947.1.70370 WP_000999947.1.70407 WP_000999947.1.70414 WP_000999947.1.70477 WP_000999947.1.70492 WP_000999947.1.7050 WP_000999947.1.70509 WP_000999947.1.7052 WP_000999947.1.70530 WP_000999947.1.70578 WP_000999947.1.70592 WP_000999947.1.70597 WP_000999947.1.70600 WP_000999947.1.70619 WP_000999947.1.70628 WP_000999947.1.70656 WP_000999947.1.70694 WP_000999947.1.70698 WP_000999947.1.70705 WP_000999947.1.70728 WP_000999947.1.70745 WP_000999947.1.70747 WP_000999947.1.70748 WP_000999947.1.70767 WP_000999947.1.70794 WP_000999947.1.70801 WP_000999947.1.70803 WP_000999947.1.70896 WP_000999947.1.7090 WP_000999947.1.70900 WP_000999947.1.70952 WP_000999947.1.70967 WP_000999947.1.71024 WP_000999947.1.71037 WP_000999947.1.71042 WP_000999947.1.71062 WP_000999947.1.71109 WP_000999947.1.71113 WP_000999947.1.71134 WP_000999947.1.71139 WP_000999947.1.71144 WP_000999947.1.71147 WP_000999947.1.71159 WP_000999947.1.71162 WP_000999947.1.71170 WP_000999947.1.71176 WP_000999947.1.71183 WP_000999947.1.71192 WP_000999947.1.71199 WP_000999947.1.71221 WP_000999947.1.71223 WP_000999947.1.71229 WP_000999947.1.71264 WP_000999947.1.71272 WP_000999947.1.71273 WP_000999947.1.71275 WP_000999947.1.71294 WP_000999947.1.71311 WP_000999947.1.71312 WP_000999947.1.71315 WP_000999947.1.71323 WP_000999947.1.71327 WP_000999947.1.71339 WP_000999947.1.71354 WP_000999947.1.71397 WP_000999947.1.71403 WP_000999947.1.71405 WP_000999947.1.71409 WP_000999947.1.71421 WP_000999947.1.7147 WP_000999947.1.71480 WP_000999947.1.71522 WP_000999947.1.71533 WP_000999947.1.71537 WP_000999947.1.71540 WP_000999947.1.71560 WP_000999947.1.71563 WP_000999947.1.71603 WP_000999947.1.71680 WP_000999947.1.71690 WP_000999947.1.71695 WP_000999947.1.71732 WP_000999947.1.71757 WP_000999947.1.71767 WP_000999947.1.71783 WP_000999947.1.71832 WP_000999947.1.71837 WP_000999947.1.71855 WP_000999947.1.71856 WP_000999947.1.71874 WP_000999947.1.7192 WP_000999947.1.71922 WP_000999947.1.71938 WP_000999947.1.71939 WP_000999947.1.71944 WP_000999947.1.71945 WP_000999947.1.71975 WP_000999947.1.71987 WP_000999947.1.71993 WP_000999947.1.71995 WP_000999947.1.72013 WP_000999947.1.72021 WP_000999947.1.72028 WP_000999947.1.72033 WP_000999947.1.7205 WP_000999947.1.72053 WP_000999947.1.72054 WP_000999947.1.72090 WP_000999947.1.7210 WP_000999947.1.72120 WP_000999947.1.72125 WP_000999947.1.72126 WP_000999947.1.72141 WP_000999947.1.72153 WP_000999947.1.72155 WP_000999947.1.72157 WP_000999947.1.72161 WP_000999947.1.72162 WP_000999947.1.72184 WP_000999947.1.72186 WP_000999947.1.72212 WP_000999947.1.72237 WP_000999947.1.72248 WP_000999947.1.7225 WP_000999947.1.72261 WP_000999947.1.72262 WP_000999947.1.72270 WP_000999947.1.72279 WP_000999947.1.72290 WP_000999947.1.72293 WP_000999947.1.72316 WP_000999947.1.72337 WP_000999947.1.72352 WP_000999947.1.72359 WP_000999947.1.72362 WP_000999947.1.72388 WP_000999947.1.72391 WP_000999947.1.72392 WP_000999947.1.72397 WP_000999947.1.72414 WP_000999947.1.72431 WP_000999947.1.72485 WP_000999947.1.72493 WP_000999947.1.72511 WP_000999947.1.72521 WP_000999947.1.72522 WP_000999947.1.72535 WP_000999947.1.72537 WP_000999947.1.72574 WP_000999947.1.72582 WP_000999947.1.72593 WP_000999947.1.72606 WP_000999947.1.72608 WP_000999947.1.72615 WP_000999947.1.72616 WP_000999947.1.72619 WP_000999947.1.72643 WP_000999947.1.72651 WP_000999947.1.72652 WP_000999947.1.72663 WP_000999947.1.72694 WP_000999947.1.72695 WP_000999947.1.72700 WP_000999947.1.72725 WP_000999947.1.72729 WP_000999947.1.72738 WP_000999947.1.72745 WP_000999947.1.72747 WP_000999947.1.72751 WP_000999947.1.72758 WP_000999947.1.72764 WP_000999947.1.72778 WP_000999947.1.72804 WP_000999947.1.72806 WP_000999947.1.7281 WP_000999947.1.72837 WP_000999947.1.72858 WP_000999947.1.72860 WP_000999947.1.72869 WP_000999947.1.72910 WP_000999947.1.72947 WP_000999947.1.72956 WP_000999947.1.72998 WP_000999947.1.73000 WP_000999947.1.73010 WP_000999947.1.73015 WP_000999947.1.73032 WP_000999947.1.73039 WP_000999947.1.7307 WP_000999947.1.73072 WP_000999947.1.73075 WP_000999947.1.73085 WP_000999947.1.73094 WP_000999947.1.73129 WP_000999947.1.73193 WP_000999947.1.73197 WP_000999947.1.73215 WP_000999947.1.73217 WP_000999947.1.73230 WP_000999947.1.73239 WP_000999947.1.73243 WP_000999947.1.73249 WP_000999947.1.73251 WP_000999947.1.73257 WP_000999947.1.73259 WP_000999947.1.73277 WP_000999947.1.73278 WP_000999947.1.73283 WP_000999947.1.73291 WP_000999947.1.73292 WP_000999947.1.73295 WP_000999947.1.73326 WP_000999947.1.73340 WP_000999947.1.73344 WP_000999947.1.73349 WP_000999947.1.73385 WP_000999947.1.73393 WP_000999947.1.73428 WP_000999947.1.73430 WP_000999947.1.7345 WP_000999947.1.73468 WP_000999947.1.73486 WP_000999947.1.7349 WP_000999947.1.73498 WP_000999947.1.73499 WP_000999947.1.73524 WP_000999947.1.73565 WP_000999947.1.73592 WP_000999947.1.73604 WP_000999947.1.73631 WP_000999947.1.73652 WP_000999947.1.73663 WP_000999947.1.73700 WP_000999947.1.73709 WP_000999947.1.73717 WP_000999947.1.73743 WP_000999947.1.73797 WP_000999947.1.73807 WP_000999947.1.73811 WP_000999947.1.73827 WP_000999947.1.73835 WP_000999947.1.73843 WP_000999947.1.73844 WP_000999947.1.73846 WP_000999947.1.73859 WP_000999947.1.73882 WP_000999947.1.73897 WP_000999947.1.73908 WP_000999947.1.73942 WP_000999947.1.73980 WP_000999947.1.73992 WP_000999947.1.73995 WP_000999947.1.73996 WP_000999947.1.74045 WP_000999947.1.74051 WP_000999947.1.74053 WP_000999947.1.74123 WP_000999947.1.7413 WP_000999947.1.74156 WP_000999947.1.74184 WP_000999947.1.74213 WP_000999947.1.74223 WP_000999947.1.7424 WP_000999947.1.74243 WP_000999947.1.7425 WP_000999947.1.74251 WP_000999947.1.74267 WP_000999947.1.74294 WP_000999947.1.74309 WP_000999947.1.74365 WP_000999947.1.74423 WP_000999947.1.74431 WP_000999947.1.74445 WP_000999947.1.74465 WP_000999947.1.74478 WP_000999947.1.74491 WP_000999947.1.74501 WP_000999947.1.74513 WP_000999947.1.74520 WP_000999947.1.74528 WP_000999947.1.74532 WP_000999947.1.7461 WP_000999947.1.74624 WP_000999947.1.74625 WP_000999947.1.74631 WP_000999947.1.74652 WP_000999947.1.74670 WP_000999947.1.74687 WP_000999947.1.74688 WP_000999947.1.74689 WP_000999947.1.74691 WP_000999947.1.74705 WP_000999947.1.7471 WP_000999947.1.74713 WP_000999947.1.74716 WP_000999947.1.74720 WP_000999947.1.74735 WP_000999947.1.7475 WP_000999947.1.74752 WP_000999947.1.74765 WP_000999947.1.7478 WP_000999947.1.7479 WP_000999947.1.74793 WP_000999947.1.74811 WP_000999947.1.74844 WP_000999947.1.74852 WP_000999947.1.74854 WP_000999947.1.74860 WP_000999947.1.74867 WP_000999947.1.74873 WP_000999947.1.74879 WP_000999947.1.74885 WP_000999947.1.74889 WP_000999947.1.74895 WP_000999947.1.74914 WP_000999947.1.74962 WP_000999947.1.74975 WP_000999947.1.74993 WP_000999947.1.74998 WP_000999947.1.75003 WP_000999947.1.75021 WP_000999947.1.75029 WP_000999947.1.75050 WP_000999947.1.75112 WP_000999947.1.75136 WP_000999947.1.75138 WP_000999947.1.75139 WP_000999947.1.75143 WP_000999947.1.75145 WP_000999947.1.75149 WP_000999947.1.75155 WP_000999947.1.7516 WP_000999947.1.75181 WP_000999947.1.75209 WP_000999947.1.75218 WP_000999947.1.75219 WP_000999947.1.75221 WP_000999947.1.75228 WP_000999947.1.75243 WP_000999947.1.75247 WP_000999947.1.75254 WP_000999947.1.75270 WP_000999947.1.75272 WP_000999947.1.75306 WP_000999947.1.7536 WP_000999947.1.75360 WP_000999947.1.75367 WP_000999947.1.75419 WP_000999947.1.75428 WP_000999947.1.75435 WP_000999947.1.75465 WP_000999947.1.75491 WP_000999947.1.75515 WP_000999947.1.75529 WP_000999947.1.75537 WP_000999947.1.75557 WP_000999947.1.75568 WP_000999947.1.75588 WP_000999947.1.75594 WP_000999947.1.75602 WP_000999947.1.75612 WP_000999947.1.75629 WP_000999947.1.75644 WP_000999947.1.75653 WP_000999947.1.75676 WP_000999947.1.75679 WP_000999947.1.75687 WP_000999947.1.75696 WP_000999947.1.75698 WP_000999947.1.75699 WP_000999947.1.75725 WP_000999947.1.75758 WP_000999947.1.75803 WP_000999947.1.75839 WP_000999947.1.75853 WP_000999947.1.7597 WP_000999947.1.75973 WP_000999947.1.75995 WP_000999947.1.75999 WP_000999947.1.76005 WP_000999947.1.76009 WP_000999947.1.7603 WP_000999947.1.76030 WP_000999947.1.76036 WP_000999947.1.76039 WP_000999947.1.76087 WP_000999947.1.76089 WP_000999947.1.76103 WP_000999947.1.76118 WP_000999947.1.76119 WP_000999947.1.76129 WP_000999947.1.7613 WP_000999947.1.7617 WP_000999947.1.76196 WP_000999947.1.76305 WP_000999947.1.76312 WP_000999947.1.76325 WP_000999947.1.76361 WP_000999947.1.7637 WP_000999947.1.76376 WP_000999947.1.76384 WP_000999947.1.76387 WP_000999947.1.76390 WP_000999947.1.76446 WP_000999947.1.76448 WP_000999947.1.76452 WP_000999947.1.76462 WP_000999947.1.76466 WP_000999947.1.76542 WP_000999947.1.76544 WP_000999947.1.76595 WP_000999947.1.7661 WP_000999947.1.76612 WP_000999947.1.76619 WP_000999947.1.76656 WP_000999947.1.76701 WP_000999947.1.76705 WP_000999947.1.76707 WP_000999947.1.76712 WP_000999947.1.7680 WP_000999947.1.76815 WP_000999947.1.76831 WP_000999947.1.76840 WP_000999947.1.76884 WP_000999947.1.7689 WP_000999947.1.76909 WP_000999947.1.76918 WP_000999947.1.76933 WP_000999947.1.76965 WP_000999947.1.76966 WP_000999947.1.7699 WP_000999947.1.77015 WP_000999947.1.77022 WP_000999947.1.77042 WP_000999947.1.77070 WP_000999947.1.771 WP_000999947.1.77109 WP_000999947.1.77120 WP_000999947.1.77134 WP_000999947.1.77147 WP_000999947.1.77162 WP_000999947.1.77173 WP_000999947.1.77175 WP_000999947.1.77200 WP_000999947.1.77214 WP_000999947.1.77224 WP_000999947.1.77255 WP_000999947.1.77258 WP_000999947.1.7728 WP_000999947.1.77284 WP_000999947.1.77288 WP_000999947.1.77291 WP_000999947.1.77296 WP_000999947.1.7731 WP_000999947.1.77326 WP_000999947.1.77341 WP_000999947.1.77358 WP_000999947.1.77391 WP_000999947.1.77437 WP_000999947.1.77448 WP_000999947.1.77452 WP_000999947.1.77455 WP_000999947.1.77462 WP_000999947.1.77470 WP_000999947.1.77471 WP_000999947.1.77487 WP_000999947.1.77495 WP_000999947.1.775 WP_000999947.1.77503 WP_000999947.1.77542 WP_000999947.1.77551 WP_000999947.1.77577 WP_000999947.1.77581 WP_000999947.1.77595 WP_000999947.1.77600 WP_000999947.1.77608 WP_000999947.1.77626 WP_000999947.1.77632 WP_000999947.1.77636 WP_000999947.1.77648 WP_000999947.1.77725 WP_000999947.1.77741 WP_000999947.1.7775 WP_000999947.1.77767 WP_000999947.1.77768 WP_000999947.1.7780 WP_000999947.1.7781 WP_000999947.1.77826 WP_000999947.1.77833 WP_000999947.1.77876 WP_000999947.1.77929 WP_000999947.1.77949 WP_000999947.1.7795 WP_000999947.1.77999 WP_000999947.1.78000 WP_000999947.1.78010 WP_000999947.1.7804 WP_000999947.1.78059 WP_000999947.1.7806 WP_000999947.1.7808 WP_000999947.1.78089 WP_000999947.1.78097 WP_000999947.1.78099 WP_000999947.1.78101 WP_000999947.1.78102 WP_000999947.1.78131 WP_000999947.1.78188 WP_000999947.1.78196 WP_000999947.1.78233 WP_000999947.1.78235 WP_000999947.1.78305 WP_000999947.1.78321 WP_000999947.1.78337 WP_000999947.1.78340 WP_000999947.1.78390 WP_000999947.1.78413 WP_000999947.1.78445 WP_000999947.1.78453 WP_000999947.1.78462 WP_000999947.1.7847 WP_000999947.1.78477 WP_000999947.1.78491 WP_000999947.1.7851 WP_000999947.1.78515 WP_000999947.1.78527 WP_000999947.1.78553 WP_000999947.1.78575 WP_000999947.1.78581 WP_000999947.1.78583 WP_000999947.1.78586 WP_000999947.1.78610 WP_000999947.1.78612 WP_000999947.1.78615 WP_000999947.1.78645 WP_000999947.1.78687 WP_000999947.1.78696 WP_000999947.1.78698 WP_000999947.1.78706 WP_000999947.1.78718 WP_000999947.1.78746 WP_000999947.1.78750 WP_000999947.1.78757 WP_000999947.1.78775 WP_000999947.1.78814 WP_000999947.1.7883 WP_000999947.1.78843 WP_000999947.1.78845 WP_000999947.1.78854 WP_000999947.1.78891 WP_000999947.1.78908 WP_000999947.1.78919 WP_000999947.1.78953 WP_000999947.1.78956 WP_000999947.1.7896 WP_000999947.1.78966 WP_000999947.1.7898 WP_000999947.1.78996 WP_000999947.1.79002 WP_000999947.1.79004 WP_000999947.1.7901 WP_000999947.1.79065 WP_000999947.1.79067 WP_000999947.1.79075 WP_000999947.1.79086 WP_000999947.1.79088 WP_000999947.1.79090 WP_000999947.1.79092 WP_000999947.1.79126 WP_000999947.1.79137 WP_000999947.1.79159 WP_000999947.1.79226 WP_000999947.1.79233 WP_000999947.1.79243 WP_000999947.1.79246 WP_000999947.1.79248 WP_000999947.1.79249 WP_000999947.1.79276 WP_000999947.1.79308 WP_000999947.1.79312 WP_000999947.1.79342 WP_000999947.1.79343 WP_000999947.1.79346 WP_000999947.1.79356 WP_000999947.1.79369 WP_000999947.1.7937 WP_000999947.1.79391 WP_000999947.1.79414 WP_000999947.1.79416 WP_000999947.1.79478 WP_000999947.1.79505 WP_000999947.1.79519 WP_000999947.1.79525 WP_000999947.1.79526 WP_000999947.1.79540 WP_000999947.1.79558 WP_000999947.1.79591 WP_000999947.1.79606 WP_000999947.1.79619 WP_000999947.1.79685 WP_000999947.1.79713 WP_000999947.1.79759 WP_000999947.1.79764 WP_000999947.1.79800 WP_000999947.1.79816 WP_000999947.1.79824 WP_000999947.1.79840 WP_000999947.1.7985 WP_000999947.1.79866 WP_000999947.1.79869 WP_000999947.1.7987 WP_000999947.1.79871 WP_000999947.1.79877 WP_000999947.1.79905 WP_000999947.1.7993 WP_000999947.1.79930 WP_000999947.1.79931 WP_000999947.1.79932 WP_000999947.1.79933 WP_000999947.1.79936 WP_000999947.1.79944 WP_000999947.1.79952 WP_000999947.1.79973 WP_000999947.1.79984 WP_000999947.1.80 WP_000999947.1.80011 WP_000999947.1.80026 WP_000999947.1.8004 WP_000999947.1.80043 WP_000999947.1.80050 WP_000999947.1.80060 WP_000999947.1.80071 WP_000999947.1.80096 WP_000999947.1.80106 WP_000999947.1.8011 WP_000999947.1.80112 WP_000999947.1.80136 WP_000999947.1.80141 WP_000999947.1.80176 WP_000999947.1.80179 WP_000999947.1.80183 WP_000999947.1.80192 WP_000999947.1.80255 WP_000999947.1.80292 WP_000999947.1.80310 WP_000999947.1.80320 WP_000999947.1.80388 WP_000999947.1.80392 WP_000999947.1.80402 WP_000999947.1.80426 WP_000999947.1.80428 WP_000999947.1.80440 WP_000999947.1.80444 WP_000999947.1.80456 WP_000999947.1.80484 WP_000999947.1.80517 WP_000999947.1.80519 WP_000999947.1.80524 WP_000999947.1.80545 WP_000999947.1.8057 WP_000999947.1.80577 WP_000999947.1.80594 WP_000999947.1.80612 WP_000999947.1.80626 WP_000999947.1.80662 WP_000999947.1.80666 WP_000999947.1.80676 WP_000999947.1.80709 WP_000999947.1.80718 WP_000999947.1.80731 WP_000999947.1.80736 WP_000999947.1.80737 WP_000999947.1.8074 WP_000999947.1.80753 WP_000999947.1.80754 WP_000999947.1.80756 WP_000999947.1.8076 WP_000999947.1.80768 WP_000999947.1.80789 WP_000999947.1.808 WP_000999947.1.80804 WP_000999947.1.80805 WP_000999947.1.80843 WP_000999947.1.80862 WP_000999947.1.80882 WP_000999947.1.80884 WP_000999947.1.80894 WP_000999947.1.8090 WP_000999947.1.8091 WP_000999947.1.80935 WP_000999947.1.80945 WP_000999947.1.80946 WP_000999947.1.80954 WP_000999947.1.80983 WP_000999947.1.80985 WP_000999947.1.810 WP_000999947.1.81026 WP_000999947.1.81032 WP_000999947.1.81034 WP_000999947.1.81036 WP_000999947.1.81056 WP_000999947.1.81071 WP_000999947.1.811 WP_000999947.1.81104 WP_000999947.1.81120 WP_000999947.1.81141 WP_000999947.1.81165 WP_000999947.1.8118 WP_000999947.1.81180 WP_000999947.1.81182 WP_000999947.1.8121 WP_000999947.1.81219 WP_000999947.1.81281 WP_000999947.1.81283 WP_000999947.1.81286 WP_000999947.1.8129 WP_000999947.1.81298 WP_000999947.1.81313 WP_000999947.1.81316 WP_000999947.1.81376 WP_000999947.1.81391 WP_000999947.1.81423 WP_000999947.1.81438 WP_000999947.1.81469 WP_000999947.1.81475 WP_000999947.1.81484 WP_000999947.1.81517 WP_000999947.1.8156 WP_000999947.1.81577 WP_000999947.1.81580 WP_000999947.1.81588 WP_000999947.1.81596 WP_000999947.1.81602 WP_000999947.1.81618 WP_000999947.1.81625 WP_000999947.1.81688 WP_000999947.1.81692 WP_000999947.1.81715 WP_000999947.1.8172 WP_000999947.1.81723 WP_000999947.1.81761 WP_000999947.1.81806 WP_000999947.1.81819 WP_000999947.1.8183 WP_000999947.1.81832 WP_000999947.1.81843 WP_000999947.1.81869 WP_000999947.1.81881 WP_000999947.1.81888 WP_000999947.1.81914 WP_000999947.1.81939 WP_000999947.1.81952 WP_000999947.1.81972 WP_000999947.1.82 WP_000999947.1.82032 WP_000999947.1.82059 WP_000999947.1.82061 WP_000999947.1.82062 WP_000999947.1.82074 WP_000999947.1.82095 WP_000999947.1.82106 WP_000999947.1.82116 WP_000999947.1.82123 WP_000999947.1.82137 WP_000999947.1.82217 WP_000999947.1.82239 WP_000999947.1.82240 WP_000999947.1.82242 WP_000999947.1.82246 WP_000999947.1.82275 WP_000999947.1.82280 WP_000999947.1.82316 WP_000999947.1.82326 WP_000999947.1.82330 WP_000999947.1.8235 WP_000999947.1.82378 WP_000999947.1.82438 WP_000999947.1.82439 WP_000999947.1.82485 WP_000999947.1.82499 WP_000999947.1.82514 WP_000999947.1.82536 WP_000999947.1.8255 WP_000999947.1.82572 WP_000999947.1.82614 WP_000999947.1.82626 WP_000999947.1.82647 WP_000999947.1.82661 WP_000999947.1.82691 WP_000999947.1.82698 WP_000999947.1.82700 WP_000999947.1.82705 WP_000999947.1.82711 WP_000999947.1.82715 WP_000999947.1.82718 WP_000999947.1.82747 WP_000999947.1.82754 WP_000999947.1.8277 WP_000999947.1.82780 WP_000999947.1.82784 WP_000999947.1.82799 WP_000999947.1.82808 WP_000999947.1.82816 WP_000999947.1.82831 WP_000999947.1.82833 WP_000999947.1.82853 WP_000999947.1.82902 WP_000999947.1.82923 WP_000999947.1.82991 WP_000999947.1.83020 WP_000999947.1.83033 WP_000999947.1.83035 WP_000999947.1.83051 WP_000999947.1.83059 WP_000999947.1.8306 WP_000999947.1.8308 WP_000999947.1.83093 WP_000999947.1.831 WP_000999947.1.83118 WP_000999947.1.83140 WP_000999947.1.83144 WP_000999947.1.83151 WP_000999947.1.83160 WP_000999947.1.83177 WP_000999947.1.83205 WP_000999947.1.83214 WP_000999947.1.83224 WP_000999947.1.83253 WP_000999947.1.83330 WP_000999947.1.83347 WP_000999947.1.83466 WP_000999947.1.83481 WP_000999947.1.83537 WP_000999947.1.83544 WP_000999947.1.83564 WP_000999947.1.83584 WP_000999947.1.83660 WP_000999947.1.8368 WP_000999947.1.83684 WP_000999947.1.83735 WP_000999947.1.83762 WP_000999947.1.83781 WP_000999947.1.83807 WP_000999947.1.83820 WP_000999947.1.83879 WP_000999947.1.83941 WP_000999947.1.83947 WP_000999947.1.84004 WP_000999947.1.84060 WP_000999947.1.84074 WP_000999947.1.8411 WP_000999947.1.84140 WP_000999947.1.84172 WP_000999947.1.84185 WP_000999947.1.84210 WP_000999947.1.84215 WP_000999947.1.84313 WP_000999947.1.84316 WP_000999947.1.84319 WP_000999947.1.84331 WP_000999947.1.84339 WP_000999947.1.84348 WP_000999947.1.84405 WP_000999947.1.84410 WP_000999947.1.84436 WP_000999947.1.8444 WP_000999947.1.84462 WP_000999947.1.84464 WP_000999947.1.8447 WP_000999947.1.84473 WP_000999947.1.84476 WP_000999947.1.84484 WP_000999947.1.84511 WP_000999947.1.84518 WP_000999947.1.84531 WP_000999947.1.84534 WP_000999947.1.84584 WP_000999947.1.84639 WP_000999947.1.84656 WP_000999947.1.84668 WP_000999947.1.84675 WP_000999947.1.84697 WP_000999947.1.8470 WP_000999947.1.84731 WP_000999947.1.84738 WP_000999947.1.84740 WP_000999947.1.84768 WP_000999947.1.84784 WP_000999947.1.84797 WP_000999947.1.84841 WP_000999947.1.84850 WP_000999947.1.84875 WP_000999947.1.84878 WP_000999947.1.84881 WP_000999947.1.84893 WP_000999947.1.84894 WP_000999947.1.84916 WP_000999947.1.84929 WP_000999947.1.84941 WP_000999947.1.84966 WP_000999947.1.84977 WP_000999947.1.84989 WP_000999947.1.84994 WP_000999947.1.85002 WP_000999947.1.85011 WP_000999947.1.85052 WP_000999947.1.85077 WP_000999947.1.85085 WP_000999947.1.85090 WP_000999947.1.85098 WP_000999947.1.85105 WP_000999947.1.85106 WP_000999947.1.85112 WP_000999947.1.85129 WP_000999947.1.85138 WP_000999947.1.85141 WP_000999947.1.85155 WP_000999947.1.85156 WP_000999947.1.8517 WP_000999947.1.85175 WP_000999947.1.85241 WP_000999947.1.85247 WP_000999947.1.85255 WP_000999947.1.85260 WP_000999947.1.85305 WP_000999947.1.85310 WP_000999947.1.85320 WP_000999947.1.85323 WP_000999947.1.85329 WP_000999947.1.85335 WP_000999947.1.85336 WP_000999947.1.85342 WP_000999947.1.85361 WP_000999947.1.85369 WP_000999947.1.85385 WP_000999947.1.85435 WP_000999947.1.85500 WP_000999947.1.85525 WP_000999947.1.85546 WP_000999947.1.85563 WP_000999947.1.8560 WP_000999947.1.85601 WP_000999947.1.85621 WP_000999947.1.85623 WP_000999947.1.8564 WP_000999947.1.85657 WP_000999947.1.85685 WP_000999947.1.85752 WP_000999947.1.85762 WP_000999947.1.85767 WP_000999947.1.8579 WP_000999947.1.85793 WP_000999947.1.85800 WP_000999947.1.85806 WP_000999947.1.85857 WP_000999947.1.85895 WP_000999947.1.8592 WP_000999947.1.85939 WP_000999947.1.85944 WP_000999947.1.85948 WP_000999947.1.86 WP_000999947.1.86001 WP_000999947.1.86016 WP_000999947.1.86035 WP_000999947.1.86063 WP_000999947.1.8607 WP_000999947.1.86105 WP_000999947.1.86110 WP_000999947.1.86115 WP_000999947.1.86145 WP_000999947.1.86149 WP_000999947.1.86161 WP_000999947.1.86176 WP_000999947.1.86181 WP_000999947.1.8621 WP_000999947.1.86210 WP_000999947.1.86263 WP_000999947.1.86266 WP_000999947.1.86276 WP_000999947.1.86280 WP_000999947.1.86283 WP_000999947.1.86294 WP_000999947.1.86307 WP_000999947.1.8635 WP_000999947.1.86353 WP_000999947.1.86355 WP_000999947.1.86371 WP_000999947.1.86393 WP_000999947.1.86411 WP_000999947.1.86412 WP_000999947.1.86437 WP_000999947.1.86451 WP_000999947.1.86452 WP_000999947.1.86454 WP_000999947.1.86461 WP_000999947.1.86475 WP_000999947.1.86492 WP_000999947.1.86518 WP_000999947.1.8652 WP_000999947.1.86583 WP_000999947.1.86598 WP_000999947.1.86609 WP_000999947.1.86617 WP_000999947.1.86640 WP_000999947.1.86667 WP_000999947.1.86673 WP_000999947.1.86674 WP_000999947.1.86681 WP_000999947.1.86691 WP_000999947.1.86707 WP_000999947.1.86727 WP_000999947.1.86731 WP_000999947.1.86768 WP_000999947.1.86787 WP_000999947.1.86788 WP_000999947.1.8679 WP_000999947.1.86833 WP_000999947.1.86846 WP_000999947.1.86848 WP_000999947.1.8687 WP_000999947.1.86935 WP_000999947.1.86956 WP_000999947.1.86959 WP_000999947.1.86975 WP_000999947.1.86997 WP_000999947.1.87043 WP_000999947.1.87059 WP_000999947.1.87075 WP_000999947.1.87109 WP_000999947.1.87147 WP_000999947.1.87177 WP_000999947.1.87189 WP_000999947.1.87199 WP_000999947.1.87249 WP_000999947.1.87310 WP_000999947.1.87339 WP_000999947.1.87358 WP_000999947.1.87371 WP_000999947.1.87389 WP_000999947.1.87400 WP_000999947.1.87410 WP_000999947.1.87465 WP_000999947.1.87557 WP_000999947.1.87563 WP_000999947.1.87568 WP_000999947.1.87574 WP_000999947.1.87608 WP_000999947.1.87610 WP_000999947.1.87635 WP_000999947.1.87639 WP_000999947.1.87655 WP_000999947.1.87694 WP_000999947.1.8771 WP_000999947.1.87721 WP_000999947.1.87726 WP_000999947.1.87728 WP_000999947.1.8778 WP_000999947.1.87786 WP_000999947.1.87788 WP_000999947.1.87789 WP_000999947.1.87822 WP_000999947.1.87834 WP_000999947.1.87857 WP_000999947.1.87914 WP_000999947.1.87973 WP_000999947.1.87976 WP_000999947.1.87980 WP_000999947.1.87984 WP_000999947.1.87989 WP_000999947.1.880 WP_000999947.1.88017 WP_000999947.1.88020 WP_000999947.1.88066 WP_000999947.1.88088 WP_000999947.1.88110 WP_000999947.1.88119 WP_000999947.1.88149 WP_000999947.1.88155 WP_000999947.1.88189 WP_000999947.1.8822 WP_000999947.1.88238 WP_000999947.1.88252 WP_000999947.1.88263 WP_000999947.1.88285 WP_000999947.1.88301 WP_000999947.1.88336 WP_000999947.1.88352 WP_000999947.1.88376 WP_000999947.1.88379 WP_000999947.1.88384 WP_000999947.1.88413 WP_000999947.1.88427 WP_000999947.1.88434 WP_000999947.1.88438 WP_000999947.1.88462 WP_000999947.1.8848 WP_000999947.1.88499 WP_000999947.1.88505 WP_000999947.1.88535 WP_000999947.1.88539 WP_000999947.1.8854 WP_000999947.1.8855 WP_000999947.1.88577 WP_000999947.1.88598 WP_000999947.1.88603 WP_000999947.1.88607 WP_000999947.1.88631 WP_000999947.1.88646 WP_000999947.1.88667 WP_000999947.1.88678 WP_000999947.1.88685 WP_000999947.1.88686 WP_000999947.1.88709 WP_000999947.1.88710 WP_000999947.1.88717 WP_000999947.1.88720 WP_000999947.1.88729 WP_000999947.1.8873 WP_000999947.1.88732 WP_000999947.1.88752 WP_000999947.1.88757 WP_000999947.1.88759 WP_000999947.1.8879 WP_000999947.1.88834 WP_000999947.1.88864 WP_000999947.1.88880 WP_000999947.1.88883 WP_000999947.1.88953 WP_000999947.1.88961 WP_000999947.1.88997 WP_000999947.1.89018 WP_000999947.1.89050 WP_000999947.1.8906 WP_000999947.1.89067 WP_000999947.1.89090 WP_000999947.1.89097 WP_000999947.1.89099 WP_000999947.1.89111 WP_000999947.1.89163 WP_000999947.1.89165 WP_000999947.1.89183 WP_000999947.1.89197 WP_000999947.1.89200 WP_000999947.1.89203 WP_000999947.1.89255 WP_000999947.1.8928 WP_000999947.1.89305 WP_000999947.1.8938 WP_000999947.1.894 WP_000999947.1.89400 WP_000999947.1.89403 WP_000999947.1.89416 WP_000999947.1.89432 WP_000999947.1.8945 WP_000999947.1.89458 WP_000999947.1.89466 WP_000999947.1.89468 WP_000999947.1.89471 WP_000999947.1.89474 WP_000999947.1.89479 WP_000999947.1.89492 WP_000999947.1.89496 WP_000999947.1.89510 WP_000999947.1.89583 WP_000999947.1.89601 WP_000999947.1.89605 WP_000999947.1.89646 WP_000999947.1.89656 WP_000999947.1.89674 WP_000999947.1.89679 WP_000999947.1.89710 WP_000999947.1.89768 WP_000999947.1.89788 WP_000999947.1.89818 WP_000999947.1.89839 WP_000999947.1.89841 WP_000999947.1.89852 WP_000999947.1.89859 WP_000999947.1.89879 WP_000999947.1.89895 WP_000999947.1.89915 WP_000999947.1.89917 WP_000999947.1.89918 WP_000999947.1.89920 WP_000999947.1.89923 WP_000999947.1.89925 WP_000999947.1.90017 WP_000999947.1.90022 WP_000999947.1.90050 WP_000999947.1.90063 WP_000999947.1.90078 WP_000999947.1.9010 WP_000999947.1.90115 WP_000999947.1.90128 WP_000999947.1.90146 WP_000999947.1.90156 WP_000999947.1.90168 WP_000999947.1.90182 WP_000999947.1.90205 WP_000999947.1.90249 WP_000999947.1.90256 WP_000999947.1.90266 WP_000999947.1.90270 WP_000999947.1.90332 WP_000999947.1.90358 WP_000999947.1.9036 WP_000999947.1.90405 WP_000999947.1.90435 WP_000999947.1.90436 WP_000999947.1.90441 WP_000999947.1.90449 WP_000999947.1.90467 WP_000999947.1.90511 WP_000999947.1.90520 WP_000999947.1.90525 WP_000999947.1.90536 WP_000999947.1.90547 WP_000999947.1.9059 WP_000999947.1.90591 WP_000999947.1.9061 WP_000999947.1.90690 WP_000999947.1.90706 WP_000999947.1.90758 WP_000999947.1.90799 WP_000999947.1.9081 WP_000999947.1.90813 WP_000999947.1.90828 WP_000999947.1.90834 WP_000999947.1.90839 WP_000999947.1.9084 WP_000999947.1.90842 WP_000999947.1.90856 WP_000999947.1.90864 WP_000999947.1.90890 WP_000999947.1.909 WP_000999947.1.90924 WP_000999947.1.90951 WP_000999947.1.90960 WP_000999947.1.90979 WP_000999947.1.90988 WP_000999947.1.91 WP_000999947.1.91007 WP_000999947.1.91010 WP_000999947.1.91018 WP_000999947.1.9104 WP_000999947.1.91094 WP_000999947.1.91113 WP_000999947.1.91117 WP_000999947.1.91121 WP_000999947.1.91138 WP_000999947.1.91143 WP_000999947.1.91170 WP_000999947.1.9118 WP_000999947.1.91182 WP_000999947.1.91213 WP_000999947.1.91266 WP_000999947.1.91268 WP_000999947.1.91277 WP_000999947.1.91290 WP_000999947.1.91340 WP_000999947.1.91341 WP_000999947.1.91354 WP_000999947.1.91361 WP_000999947.1.91397 WP_000999947.1.91414 WP_000999947.1.91425 WP_000999947.1.91445 WP_000999947.1.91462 WP_000999947.1.91485 WP_000999947.1.915 WP_000999947.1.91511 WP_000999947.1.91526 WP_000999947.1.91543 WP_000999947.1.91549 WP_000999947.1.91551 WP_000999947.1.9157 WP_000999947.1.91594 WP_000999947.1.91596 WP_000999947.1.9160 WP_000999947.1.91630 WP_000999947.1.91643 WP_000999947.1.91644 WP_000999947.1.91672 WP_000999947.1.91685 WP_000999947.1.9169 WP_000999947.1.91701 WP_000999947.1.9171 WP_000999947.1.91777 WP_000999947.1.91779 WP_000999947.1.91782 WP_000999947.1.91787 WP_000999947.1.91793 WP_000999947.1.91850 WP_000999947.1.91863 WP_000999947.1.91879 WP_000999947.1.91951 WP_000999947.1.91965 WP_000999947.1.91971 WP_000999947.1.91994 WP_000999947.1.92014 WP_000999947.1.92019 WP_000999947.1.92029 WP_000999947.1.92031 WP_000999947.1.92058 WP_000999947.1.921 WP_000999947.1.92102 WP_000999947.1.92114 WP_000999947.1.9215 WP_000999947.1.92161 WP_000999947.1.92163 WP_000999947.1.92180 WP_000999947.1.92195 WP_000999947.1.92215 WP_000999947.1.92224 WP_000999947.1.92295 WP_000999947.1.92304 WP_000999947.1.92311 WP_000999947.1.92323 WP_000999947.1.92361 WP_000999947.1.92384 WP_000999947.1.92434 WP_000999947.1.92462 WP_000999947.1.92473 WP_000999947.1.92495 WP_000999947.1.92496 WP_000999947.1.92506 WP_000999947.1.92532 WP_000999947.1.92535 WP_000999947.1.9255 WP_000999947.1.92568 WP_000999947.1.92571 WP_000999947.1.92577 WP_000999947.1.92614 WP_000999947.1.92615 WP_000999947.1.92634 WP_000999947.1.9264 WP_000999947.1.9266 WP_000999947.1.92668 WP_000999947.1.92693 WP_000999947.1.92708 WP_000999947.1.92719 WP_000999947.1.92742 WP_000999947.1.92750 WP_000999947.1.92780 WP_000999947.1.92781 WP_000999947.1.92792 WP_000999947.1.92793 WP_000999947.1.92796 WP_000999947.1.92845 WP_000999947.1.92865 WP_000999947.1.92882 WP_000999947.1.92886 WP_000999947.1.92932 WP_000999947.1.92943 WP_000999947.1.92953 WP_000999947.1.92989 WP_000999947.1.92991 WP_000999947.1.93005 WP_000999947.1.93016 WP_000999947.1.93017 WP_000999947.1.93019 WP_000999947.1.93033 WP_000999947.1.93048 WP_000999947.1.93052 WP_000999947.1.93054 WP_000999947.1.93072 WP_000999947.1.93085 WP_000999947.1.93100 WP_000999947.1.93112 WP_000999947.1.93138 WP_000999947.1.93167 WP_000999947.1.93175 WP_000999947.1.93233 WP_000999947.1.93252 WP_000999947.1.93267 WP_000999947.1.9327 WP_000999947.1.93276 WP_000999947.1.9331 WP_000999947.1.93312 WP_000999947.1.93338 WP_000999947.1.93379 WP_000999947.1.93388 WP_000999947.1.93453 WP_000999947.1.93463 WP_000999947.1.93464 WP_000999947.1.93468 WP_000999947.1.93509 WP_000999947.1.93531 WP_000999947.1.9356 WP_000999947.1.93569 WP_000999947.1.93621 WP_000999947.1.93626 WP_000999947.1.93629 WP_000999947.1.93634 WP_000999947.1.93637 WP_000999947.1.93652 WP_000999947.1.93665 WP_000999947.1.93673 WP_000999947.1.93716 WP_000999947.1.93733 WP_000999947.1.93737 WP_000999947.1.93742 WP_000999947.1.93743 WP_000999947.1.93745 WP_000999947.1.93755 WP_000999947.1.938 WP_000999947.1.93800 WP_000999947.1.93873 WP_000999947.1.93877 WP_000999947.1.939 WP_000999947.1.93900 WP_000999947.1.93911 WP_000999947.1.93918 WP_000999947.1.93921 WP_000999947.1.93922 WP_000999947.1.93951 WP_000999947.1.93952 WP_000999947.1.94008 WP_000999947.1.94011 WP_000999947.1.94025 WP_000999947.1.94028 WP_000999947.1.94057 WP_000999947.1.94156 WP_000999947.1.9416 WP_000999947.1.94176 WP_000999947.1.94187 WP_000999947.1.94271 WP_000999947.1.94298 WP_000999947.1.94317 WP_000999947.1.94353 WP_000999947.1.94388 WP_000999947.1.94404 WP_000999947.1.94417 WP_000999947.1.94429 WP_000999947.1.94430 WP_000999947.1.94445 WP_000999947.1.94468 WP_000999947.1.94475 WP_000999947.1.94497 WP_000999947.1.94507 WP_000999947.1.94516 WP_000999947.1.94523 WP_000999947.1.94548 WP_000999947.1.9457 WP_000999947.1.94578 WP_000999947.1.94580 WP_000999947.1.94626 WP_000999947.1.94653 WP_000999947.1.94690 WP_000999947.1.94692 WP_000999947.1.94695 WP_000999947.1.94738 WP_000999947.1.94753 WP_000999947.1.94754 WP_000999947.1.94764 WP_000999947.1.94787 WP_000999947.1.948 WP_000999947.1.94801 WP_000999947.1.94806 WP_000999947.1.94808 WP_000999947.1.94822 WP_000999947.1.94823 WP_000999947.1.94836 WP_000999947.1.94841 WP_000999947.1.94847 WP_000999947.1.94877 WP_000999947.1.94880 WP_000999947.1.94889 WP_000999947.1.9489 WP_000999947.1.94892 WP_000999947.1.94898 WP_000999947.1.949 WP_000999947.1.94903 WP_000999947.1.9491 WP_000999947.1.94935 WP_000999947.1.94938 WP_000999947.1.94949 WP_000999947.1.94955 WP_000999947.1.94963 WP_000999947.1.94997 WP_000999947.1.95005 WP_000999947.1.95022 WP_000999947.1.95036 WP_000999947.1.95037 WP_000999947.1.95062 WP_000999947.1.95080 WP_000999947.1.95105 WP_000999947.1.9513 WP_000999947.1.95161 WP_000999947.1.95198 WP_000999947.1.95233 WP_000999947.1.95244 WP_000999947.1.95275 WP_000999947.1.95329 WP_000999947.1.95332 WP_000999947.1.95366 WP_000999947.1.95368 WP_000999947.1.95378 WP_000999947.1.95381 WP_000999947.1.95390 WP_000999947.1.95395 WP_000999947.1.95400 WP_000999947.1.95403 WP_000999947.1.95424 WP_000999947.1.95428 WP_000999947.1.95431 WP_000999947.1.95438 WP_000999947.1.95490 WP_000999947.1.95518 WP_000999947.1.95521 WP_000999947.1.95563 WP_000999947.1.9559 WP_000999947.1.95595 WP_000999947.1.95596 WP_000999947.1.95604 WP_000999947.1.95611 WP_000999947.1.95655 WP_000999947.1.9566 WP_000999947.1.95666 WP_000999947.1.95680 WP_000999947.1.95756 WP_000999947.1.95759 WP_000999947.1.95771 WP_000999947.1.95783 WP_000999947.1.95784 WP_000999947.1.95800 WP_000999947.1.95821 WP_000999947.1.95824 WP_000999947.1.95827 WP_000999947.1.95835 WP_000999947.1.95846 WP_000999947.1.95849 WP_000999947.1.95865 WP_000999947.1.95869 WP_000999947.1.95916 WP_000999947.1.95919 WP_000999947.1.95929 WP_000999947.1.95931 WP_000999947.1.95932 WP_000999947.1.95951 WP_000999947.1.960 WP_000999947.1.96032 WP_000999947.1.96053 WP_000999947.1.96066 WP_000999947.1.96086 WP_000999947.1.96110 WP_000999947.1.96114 WP_000999947.1.96145 WP_000999947.1.96177 WP_000999947.1.96215 WP_000999947.1.96222 WP_000999947.1.96223 WP_000999947.1.96229 WP_000999947.1.96247 WP_000999947.1.96263 WP_000999947.1.96278 WP_000999947.1.96290 WP_000999947.1.96293 WP_000999947.1.96299 WP_000999947.1.96303 WP_000999947.1.9631 WP_000999947.1.96339 WP_000999947.1.96341 WP_000999947.1.96378 WP_000999947.1.96394 WP_000999947.1.96417 WP_000999947.1.96420 WP_000999947.1.96457 WP_000999947.1.96479 WP_000999947.1.96480 WP_000999947.1.96484 WP_000999947.1.96494 WP_000999947.1.96519 WP_000999947.1.96541 WP_000999947.1.96562 WP_000999947.1.9657 WP_000999947.1.96585 WP_000999947.1.96609 WP_000999947.1.9661 WP_000999947.1.96617 WP_000999947.1.96659 WP_000999947.1.9668 WP_000999947.1.96683 WP_000999947.1.96701 WP_000999947.1.9671 WP_000999947.1.96743 WP_000999947.1.96753 WP_000999947.1.96779 WP_000999947.1.96820 WP_000999947.1.96850 WP_000999947.1.96894 WP_000999947.1.9690 WP_000999947.1.9691 WP_000999947.1.96924 WP_000999947.1.96936 WP_000999947.1.96944 WP_000999947.1.96971 WP_000999947.1.96984 WP_000999947.1.96989 WP_000999947.1.97011 WP_000999947.1.97027 WP_000999947.1.97049 WP_000999947.1.97059 WP_000999947.1.9708 WP_000999947.1.97119 WP_000999947.1.97123 WP_000999947.1.97147 WP_000999947.1.97170 WP_000999947.1.97195 WP_000999947.1.97200 WP_000999947.1.97226 WP_000999947.1.97231 WP_000999947.1.97238 WP_000999947.1.97247 WP_000999947.1.97248 WP_000999947.1.97344 WP_000999947.1.97351 WP_000999947.1.97356 WP_000999947.1.97360 WP_000999947.1.97361 WP_000999947.1.97418 WP_000999947.1.97421 WP_000999947.1.97434 WP_000999947.1.97439 WP_000999947.1.97459 WP_000999947.1.97464 WP_000999947.1.97490 WP_000999947.1.97527 WP_000999947.1.97538 WP_000999947.1.97544 WP_000999947.1.97560 WP_000999947.1.97619 WP_000999947.1.97667 WP_000999947.1.97675 WP_000999947.1.97677 WP_000999947.1.97685 WP_000999947.1.97705 WP_000999947.1.97711 WP_000999947.1.97775 WP_000999947.1.97802 WP_000999947.1.97822 WP_000999947.1.97823 WP_000999947.1.97825 WP_000999947.1.97890 WP_000999947.1.97895 WP_000999947.1.97919 WP_000999947.1.97930 WP_000999947.1.97932 WP_000999947.1.97937 WP_000999947.1.97962 WP_000999947.1.97982 WP_000999947.1.97996 WP_000999947.1.98005 WP_000999947.1.98026 WP_000999947.1.9803 WP_000999947.1.98082 WP_000999947.1.98115 WP_000999947.1.98139 WP_000999947.1.9816 WP_000999947.1.98167 WP_000999947.1.9817 WP_000999947.1.98202 WP_000999947.1.98208 WP_000999947.1.98220 WP_000999947.1.98232 WP_000999947.1.98235 WP_000999947.1.98239 WP_000999947.1.98241 WP_000999947.1.98244 WP_000999947.1.98284 WP_000999947.1.98292 WP_000999947.1.98294 WP_000999947.1.98301 WP_000999947.1.98355 WP_000999947.1.98357 WP_000999947.1.98400 WP_000999947.1.98404 WP_000999947.1.98424 WP_000999947.1.9844 WP_000999947.1.98442 WP_000999947.1.98466 WP_000999947.1.98498 WP_000999947.1.98549 WP_000999947.1.98578 WP_000999947.1.9858 WP_000999947.1.98587 WP_000999947.1.98603 WP_000999947.1.98614 WP_000999947.1.98626 WP_000999947.1.98628 WP_000999947.1.98633 WP_000999947.1.98641 WP_000999947.1.98654 WP_000999947.1.98665 WP_000999947.1.98668 WP_000999947.1.98683 WP_000999947.1.98702 WP_000999947.1.98776 WP_000999947.1.98784 WP_000999947.1.98795 WP_000999947.1.98849 WP_000999947.1.98875 WP_000999947.1.98886 WP_000999947.1.98908 WP_000999947.1.98976 WP_000999947.1.98988 WP_000999947.1.99029 WP_000999947.1.99046 WP_000999947.1.99053 WP_000999947.1.9907 WP_000999947.1.99110 WP_000999947.1.99168 WP_000999947.1.99182 WP_000999947.1.99209 WP_000999947.1.99246 WP_000999947.1.99265 WP_000999947.1.99289 WP_000999947.1.99292 WP_000999947.1.99295 WP_000999947.1.99302 WP_000999947.1.99304 WP_000999947.1.99307 WP_000999947.1.99319 WP_000999947.1.99334 WP_000999947.1.99345 WP_000999947.1.9935 WP_000999947.1.99361 WP_000999947.1.99366 WP_000999947.1.9940 WP_000999947.1.99427 WP_000999947.1.99446 WP_000999947.1.99453 WP_000999947.1.99471 WP_000999947.1.99475 WP_000999947.1.99486 WP_000999947.1.99498 WP_000999947.1.99511 WP_000999947.1.99534 WP_000999947.1.99562 WP_000999947.1.99592 WP_000999947.1.99602 WP_000999947.1.99603 WP_000999947.1.99619 WP_000999947.1.99632 WP_000999947.1.99641 WP_000999947.1.99666 WP_000999947.1.99698 WP_000999947.1.99734 WP_000999947.1.99774 WP_000999947.1.99791 WP_000999947.1.99804 WP_000999947.1.99827 WP_000999947.1.99869 WP_000999947.1.99891 WP_000999947.1.99912 YP_002414960.1.14968 YP_006781615.1.12065 YP_405364.1.10455 gi|387623459|ref|YP_006131087.1| gi|260846420|ref|YP_003224198.1| 300267.SDY_3938 300269.SSON_3980 316385.ECDH10B_3998 316407.cyaY 331111.EcE24377A_4322 409438.ECSE_4088 481805.EcolC_4200 511145.b3807 573235.ECO26_4782 585034.ECIAI1_3994 585055.EC55989_4277 585056.ECUMN_4331 585395.ECO103_4360 585396.ECO111_4630 595496.BWG_3486 2044185448 gi|218707441|ref|YP_002414960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]