SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|89893125|ref|YP_516612.1| from Desulfitobacterium hafniense Y51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89893125|ref|YP_516612.1|
Domain Number 1 Region: 35-253,292-331
Classification Level Classification E-value
Superfamily Folate-binding domain 2.35e-44
Family Aminomethyltransferase folate-binding domain 0.00051
Further Details:      
 
Weak hits

Sequence:  gi|89893125|ref|YP_516612.1|
Domain Number - Region: 382-431
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.000414
Family Aminomethyltransferase beta-barrel domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|89893125|ref|YP_516612.1|
Sequence length 469
Comment hypothetical protein DSY0379 [Desulfitobacterium hafniense Y51]
Sequence
MSSDNQRAQFQVVTGNESPAIYHQFSPALETATLLFQMAPGLLVPYEFGGVEYEIDGYRK
SAWIGTTLMISPIYDVVGPDAVKFLNSICVNDFTNLTTKGLRHAVICNDQGQVLTDGVVI
RIGEDRYRTYWLNPPIDYFLKTSGMNVAGEDLSGTEYFIQIAGERSLEILEDAFASDLHD
IKFATHRKASMDGKEVEIIRLGMSGNLAYEIHGPMAEFDEVYRKIWNSGQKFGARKLGMH
AYNLFNHTEAGFPNIHLHYPLPWFESGEDMAKYMLANPQYSMYNLNRKLVGSVGEELQAR
FVTPYDVGWGFLVKFNHEFRGRKALEEIANDPPRTAVTLEWNGDDVGAVFATQFKPGEEA
CESIGAESEGMFTSNTFRGEMAYRSNRVLYNGKDIGISSGRIVSYHYNSMISLGFIDPAY
AKEGNELTLIWGTPGTRQMNIRVKVARYPYNGDFVRNENKDVEEIPRHK
Download sequence
Identical sequences A0A0W1JKF4 Q250X4
138119.DSY0379 gi|89893125|ref|YP_516612.1| WP_011459044.1.73069 WP_011459044.1.80252 WP_011459044.1.94859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]