SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|89894340|ref|YP_517827.1| from Desulfitobacterium hafniense Y51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89894340|ref|YP_517827.1|
Domain Number 1 Region: 25-129
Classification Level Classification E-value
Superfamily YheA/YmcA-like 7.85e-28
Family YheA-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|89894340|ref|YP_517827.1|
Sequence length 152
Comment hypothetical protein DSY1594 [Desulfitobacterium hafniense Y51]
Sequence
MKAQSRNQEKRVESIEDGGVVMTAEIMEKAEVLAAAIAKSVELQNLRSTEEAMMADEQAQ
QIIADFQNEQQRVYELQAQGQELTDEVQQAIDAMEAKVEGYPPIAAYLQAQEQFTKMLDT
INGVLAQAIANDPNGGGCSCDTGCSGCGGSCS
Download sequence
Identical sequences G9XM96
138119.DSY1594 gi|89894340|ref|YP_517827.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]