SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|89894366|ref|YP_517853.1| from Desulfitobacterium hafniense Y51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89894366|ref|YP_517853.1|
Domain Number 1 Region: 12-83,162-333
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.42e-66
Family Bacterial dinuclear zinc exopeptidases 0.0000022
Further Details:      
 
Domain Number 2 Region: 73-150
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 0.000000000000626
Family Aminopeptidase/glucanase lid domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|89894366|ref|YP_517853.1|
Sequence length 336
Comment hypothetical protein DSY1620 [Desulfitobacterium hafniense Y51]
Sequence
MPYDHKPLDYTLLERLTQCFGPSGVEGNVNSLIAEEIRPYCDEINTDALGNLMAVRRGTG
KKIMIAAHADEIGVMITHIDEKGFLRFAPLGGVSIQGLPHRRVQFQNGLMGTIGVEKLEK
PTDLKLNKLYIDIGATSLEESKAKVQVGESAVFVGSFHKQAKRLTAKALDDRVGCFIAIE
VLKRLQTQHEVYFVFTVQEEVGVRGAQTAAFALEPDLALAVDVTGTGDTPKSHPMDVKLG
QGVAIKVFDRSMITHPKIKSWMAQTAEQHHIPYQWEVLEFGGTDSGAIHLTKGGIPSGVV
SIPTRYIHSPSEMVDQGDIEGAAQLLLALLEGPAEL
Download sequence
Identical sequences A0A098AYI1 B8FX71 G9XMC7 Q24X33
gi|89894366|ref|YP_517853.1| 138119.DSY1620 272564.Dhaf_2766 WP_005811663.1.13927 WP_005811663.1.73069 WP_005811663.1.80252 WP_005811663.1.94859 gi|219668791|ref|YP_002459226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]