SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|89894368|ref|YP_517855.1| from Desulfitobacterium hafniense Y51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89894368|ref|YP_517855.1|
Domain Number 1 Region: 10-87,174-342
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.29e-62
Family Bacterial dinuclear zinc exopeptidases 0.0000224
Further Details:      
 
Domain Number 2 Region: 75-179
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.68e-21
Family Aminopeptidase/glucanase lid domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|89894368|ref|YP_517855.1|
Sequence length 353
Comment hypothetical protein DSY1622 [Desulfitobacterium hafniense Y51]
Sequence
MNNAQLSSAKEFLKQLSENSGVSGYEETLAPLVLAAFTPLADQVGQDALGNIYAHKKGTQ
GRYKIMLAAHMDEIGLMVKGIEPSGFLRFTPVGGVDQRTLLSQEVIVHGRKPVLGVIGST
PPHLMTAGEEKAVKAEQMGIDVGMTFEQIKEVIQVGDIITLRRNTLELLNHVLAGKSFDD
RAGVVVMKICLEELQRLQHAHDVIAVSTTQEEVGYRGATTSAYSLNPDLAIAIDVTHAST
PDTKGQVEKELGKGPAIALGPNIHPFVYEELVKAAKEARIPYQNHPVPGRSGTDAWAIQV
TQAGVPTGLVSIPLRYMHTSVETIDMQDVILTGKLLAYFIAGLPEDLEGRVCY
Download sequence
Identical sequences A0A098B1D9 B8FX73 Q24X31
WP_011459800.1.13927 WP_011459800.1.73069 WP_011459800.1.80252 WP_011459800.1.88067 WP_011459800.1.94859 gi|219668793|ref|YP_002459228.1| gi|89894368|ref|YP_517855.1| 138119.DSY1622 272564.Dhaf_2768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]