SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|89895048|ref|YP_518535.1| from Desulfitobacterium hafniense Y51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89895048|ref|YP_518535.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.73e-25
Family Anti-sigma factor antagonist SpoIIaa 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|89895048|ref|YP_518535.1|
Sequence length 115
Comment hypothetical protein DSY2302 [Desulfitobacterium hafniense Y51]
Sequence
MLIDKKLERQTLLLTLKGELDMNTSESLRQTIDSEIERRGVRTVILNLEDISFIDSSGLG
VILGRYKKLLPMGGKVIITRVPPHIYKIMELSGLPRIIQFEDILNQEDGRKGKTV
Download sequence
Identical sequences A0A098B1Y1 B8FPM6 G9XLC4 Q24V51
gi|219669459|ref|YP_002459894.1| WP_005811044.1.13927 WP_005811044.1.73069 WP_005811044.1.80252 WP_005811044.1.88067 WP_005811044.1.94859 gi|89895048|ref|YP_518535.1| 138119.DSY2302 272564.Dhaf_3440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]