SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|89895626|ref|YP_519113.1| from Desulfitobacterium hafniense Y51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89895626|ref|YP_519113.1|
Domain Number 1 Region: 3-282
Classification Level Classification E-value
Superfamily Folate-binding domain 3.45e-108
Family Aminomethyltransferase folate-binding domain 0.000000223
Further Details:      
 
Domain Number 2 Region: 275-364
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 2.13e-25
Family Aminomethyltransferase beta-barrel domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|89895626|ref|YP_519113.1|
Sequence length 365
Comment hypothetical protein DSY2880 [Desulfitobacterium hafniense Y51]
Sequence
MTELKRTPLYEQHRRAGAKLIDFGGWEMPVQYAGVIEEHKAVRSKAGLFDVSHMGEVELK
GKDSLAFLQYLLTNDVSRIQDNQIQYSPMCTSAGGVVDDLLVYRYSREHFLLVVNAANTD
KDFAWMQAQAEGFEISLENRSGDFAQLALQGPWAEKILQKLTSMDLAQINYYWFKHGEVD
GVLCLISRTGYTGEDGFEIYLPPEHAPRMWERILEVGGSEGVQPIGLGARDTLRFEARLP
LYGNELGPDITPLEAGLGFFVKLEKDNFIGKEALSAQKEKGVPRKLVGLEMIERGIARSH
YPLQKEGKEIGFITSGSFSPTLNKNIALGLIPPEYAQIGETLDVIIRGKAVKARIIPSLF
YKRQG
Download sequence
Identical sequences A0A0W1JJY9 Q24TH3
WP_011460676.1.80252 WP_011460676.1.94859 gi|89895626|ref|YP_519113.1| 138119.DSY2880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]