SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|89895672|ref|YP_519159.1| from Desulfitobacterium hafniense Y51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89895672|ref|YP_519159.1|
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily YheA/YmcA-like 1.24e-29
Family YheA-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|89895672|ref|YP_519159.1|
Sequence length 124
Comment hypothetical protein DSY2926 [Desulfitobacterium hafniense Y51]
Sequence
MSIYETAQQLAQQIKESDEYRDFIVAKELMKADEGHYKMIRDFQMKQFEIQQAQLFQLDI
SQGKQQELERLYSLLSLNPAAREYLEAEFRISRMINDVQKIIGEAIIDVLPLGFEDNDQP
QILA
Download sequence
Identical sequences Q24TC7
WP_011460709.1.73069 WP_011460709.1.80252 WP_011460709.1.82035 WP_011460709.1.88067 gi|89895672|ref|YP_519159.1| 138119.DSY2926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]