SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|89895738|ref|YP_519225.1| from Desulfitobacterium hafniense Y51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89895738|ref|YP_519225.1|
Domain Number 1 Region: 201-391
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.79e-64
Family Methylesterase CheB, C-terminal domain 0.00000809
Further Details:      
 
Domain Number 2 Region: 6-112
Classification Level Classification E-value
Superfamily CheY-like 1.57e-28
Family CheY-related 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|89895738|ref|YP_519225.1|
Sequence length 392
Comment hypothetical protein DSY2992 [Desulfitobacterium hafniense Y51]
Sequence
MNQPKSPITVLIVDDSPFMRLTLQKILSQDPEIKVLDTARDGKEGIEKLQALRPQVVTMD
IEMPQIDGLQALGEIMRWQPTPIIILSALTTEGAQASVKALEAGAFDVVAKPSGGPGADI
QALARDLIDKVKAAAQVNLGRLGKKGAVSRISSASGSRPPWTAGAASENTNRLSSPGSTS
STLGSAKGRSLDSGEALPKYPVEIVAIGTSTGGPSALQAVLTQLPGNLPVPVLVAQHMPP
GFTAPLAQRLNGMSPLTIREGVHGEALKAGTIYFAPAGKQMQVQSRGSQLILHIGDESPI
TTLYHPSVDVMFMSLAKEVGKGTLGVVMTGMGNDGLRGMREIKERGGYAIAEAEETCVVY
GMPRAIVDAGLANRVAPLGEIARHIVECVQRR
Download sequence
Identical sequences Q24T61
138119.DSY2992 gi|89895738|ref|YP_519225.1| WP_011460762.1.80252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]