SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|89897777|ref|YP_521264.1| from Desulfitobacterium hafniense Y51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89897777|ref|YP_521264.1|
Domain Number 1 Region: 56-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 8.63e-29
Family Ribosomal protein L9 C-domain 0.0000837
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 2.96e-18
Family Ribosomal protein L9 N-domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|89897777|ref|YP_521264.1|
Sequence length 148
Comment 50S ribosomal protein L9 [Desulfitobacterium hafniense Y51]
Sequence
MKVILKADVKALGKKGQVYEVSDGYARNFLFPKGLAVEATSGNLNDLASKKANEEKKKEQ
EKQEAQTLAAKLSSLSIEIHTKSGEGGRLFGSVTNKEIAEALKASHGINLDRRKLELKEP
IKALGTFNVQAKLHPEVTAQFQVHVKAS
Download sequence
Identical sequences A0A098B9Z2 B8G0I9 G9XSX3 Q24MC2
gi|89897777|ref|YP_521264.1| gi|219670926|ref|YP_002461361.1| WP_005815187.1.13927 WP_005815187.1.73069 WP_005815187.1.80252 WP_005815187.1.88067 WP_005815187.1.94859 138119.DSY5031 272564.Dhaf_4931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]