SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|89894739|ref|YP_518226.1| from Desulfitobacterium hafniense Y51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|89894739|ref|YP_518226.1|
Domain Number 1 Region: 449-551
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000549
Family Anti-sigma factor antagonist SpoIIaa 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|89894739|ref|YP_518226.1|
Sequence length 601
Comment hypothetical protein DSY1993 [Desulfitobacterium hafniense Y51]
Sequence
MNTAVLKLEKHLPLIDTLRTYKKEYIKKDITAALTVAVIAVPQSMAYALIAGVNPVYGLY
TAIVSTIFCSLFSSSNHLIGGPTNAIALLVASGMKNYMALENAYEILFLLTFLVGAMQLL
FGVLRLGKLINFVSHSVIVGFTAGAAVLIGLGQLNSFLGISIPNSSEMSTLNKLVYIATH
LGTVNYYALGLGLLSIFVIMICKRINKNLPGALLGVCLSSALVAMFSLEQFGVKLTGTIP
SQLPPFKMIHFDLGMAGELLSGAFAIAIIALVEAISISKAIASQSRQKIDANQEIIGQGI
TNVVAPFFQCFPGTGSFSRSAINFQSGAATRIAGILSGVFVAIVLLFLGSYAKYIPMASL
AGVILNIAYNMVNRAEIKRIFKLNKADALVMGTTAIAAVLLPHLDTAVYLGIAVSIMIYL
REGSKVHIKILTPAQGKENAFLEKEIQSVEEKADTLIVHIQGNLYFGCADELEKKLDLLV
GKAGIVIIRMKRVNSIDVTSLDTLKLFVQKIKETGGKVIISGVSSNVDKLLTESKLAQQI
GEENIFISQEDLFASSNQALNRAKYFLDYDISKVKEMFSNSTLVFNDQFDSSRQAVSQNT
N
Download sequence
Identical sequences A0A098B141 Q24W10
WP_011459981.1.80252 138119.DSY1993 gi|89894739|ref|YP_518226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]