SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302384867|ref|YP_003820689.1| from Clostridium saccharolyticum WM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302384867|ref|YP_003820689.1|
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily L28p-like 1.73e-24
Family Ribosomal protein L31p 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302384867|ref|YP_003820689.1|
Sequence length 69
Comment 50S ribosomal protein L31 [Clostridium saccharolyticum WM1]
Sequence
MKEGIHPNYYQAKVVCNCGNEFVTGSTKEDIHVEVCSKCHSFYTGQQKAASARGRIDKFN
RKYGVKAEA
Download sequence
Identical sequences A0A011A1X9 A0A084JQJ9 A0A0U5P6A3 A0A1I0FY53 A0A1I0J7W6 D9R3V3
WP_013271164.1.17436 WP_013271164.1.20439 WP_013271164.1.2233 WP_013271164.1.26132 WP_013271164.1.60902 WP_013271164.1.66578 WP_013271164.1.74932 WP_013271164.1.85205 gi|302384867|ref|YP_003820689.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]