SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302386337|ref|YP_003822159.1| from Clostridium saccharolyticum WM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302386337|ref|YP_003822159.1|
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily L28p-like 3.92e-20
Family Ribosomal protein L28 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302386337|ref|YP_003822159.1|
Sequence length 61
Comment 50S ribosomal protein L28 [Clostridium saccharolyticum WM1]
Sequence
MAKCAICEKAAHFGNAVSHSHRRSNKMWKANVKSVKVKVNGGAKKMYVCTSCLRSGLVER
A
Download sequence
Identical sequences A0A174KG42 A0A2K2TP03 D3ALV0 D9R085 G5IG38 R5TUW7
WP_006775035.1.13147 WP_006775035.1.20439 WP_006775035.1.2233 WP_006775035.1.54224 WP_006775035.1.74932 WP_006775035.1.81124 gi|302386337|ref|YP_003822159.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]