SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302388490|ref|YP_003824312.1| from Clostridium saccharolyticum WM1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|302388490|ref|YP_003824312.1|
Domain Number - Region: 85-130
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0504
Family Methyl-CpG-binding domain, MBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302388490|ref|YP_003824312.1|
Sequence length 153
Comment hypothetical protein Closa_4187 [Clostridium saccharolyticum WM1]
Sequence
MKIETCTKETFAVIGKEGATNDGEGFIQKLWDDANSHFNEIAHLAKRDDKGNLLGIWGAM
SDFSRLFNPWDHFSQGLYLAGVECSDDAEAPYGWTKWLVPGYEYIYVENENNNTFPDVIK
YLEENNISLAGAVNDFICPETGKNYMFFPVRRL
Download sequence
Identical sequences D9R2R5
WP_013274741.1.20439 gi|302388490|ref|YP_003824312.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]