SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158421478|ref|YP_001527705.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158421478|ref|YP_001527705.1|
Domain Number 1 Region: 129-257
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.2e-32
Family Single strand DNA-binding domain, SSB 0.0001
Further Details:      
 
Domain Number 2 Region: 2-128
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.77e-21
Family Single strand DNA-binding domain, SSB 0.000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158421478|ref|YP_001527705.1|
Sequence length 283
Comment single-strand binding protein [Deinococcus geothermalis DSM 11300]
Sequence
MRGMNQMTVVAALTRDAELRYTPGGTAVLEYTLAGERAEVRGGEVKQVPFYLAMTTLGKA
AEALAERLKQGTAILVSGTLVQERWDDPQGGGKRSKVKGKALRVEELAGKFELVQDAGGG
VRLKGGSALVALGGNLTRDAELRYTPAGEAVMTFSIAVNETWTDSQGQRQEKPHYFEVEL
WREQAEAFAAFAPKKGQPVFVEGAPQSQTWTDRDGNKRSGVKVSATNVILLKGGDGPARE
GAPAHQPATTGAARGGRAAAVAPRAGSLDIDQGLASSEEDLLF
Download sequence
Identical sequences A8ZR98
gi|158421478|ref|YP_001527705.1|NC_009939 319795.Dgeo_2964 WP_012173375.1.71355 gi|158421478|ref|YP_001527705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]