SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158421483|ref|YP_001527710.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158421483|ref|YP_001527710.1|
Domain Number 1 Region: 125-231
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.11e-17
Family Single strand DNA-binding domain, SSB 0.00069
Further Details:      
 
Domain Number 2 Region: 250-342
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000514
Family Single strand DNA-binding domain, SSB 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158421483|ref|YP_001527710.1|
Sequence length 352
Comment single-strand binding protein [Deinococcus geothermalis DSM 11300]
Sequence
MPSQAAVHVAAQREKAGGAAARGVRRRKEMPWPDPSPHRRQRSPHRHPPFQKEAPHAPEI
HPAPDPSDQLRRTGGQRPPHHRRWRSTHHTGQRPPDHRRRAVTPLLLPDETAALANWAEK
RGTDMTNKVTLIGALVRAPEFKTTPSGTSVFEGTLAGERPAVDENGTLRMKPWYVRFFAL
GRFAEALQARGLQPGAALYAPGCLDYNTFDLAERTEKGSTTRVKIEELHAVRVPWAIAQE
KGAFRMKGGVNEAELSGNLTRDAVSQDTTTGQLTRATLGVTMYSGSREPRRGYFDLKGWR
GEGQPLMGLPKGAGVTVKGPIITEPYPDPKDPSRRRTAVLIEVERVLPFIRM
Download sequence
Identical sequences A8ZRA3
gi|158421483|ref|YP_001527710.1| gi|158421483|ref|YP_001527710.1|NC_009939 319795.Dgeo_2969 WP_012173370.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]