SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158421496|ref|YP_001527723.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158421496|ref|YP_001527723.1|
Domain Number 1 Region: 184-287
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000628
Family Multidrug resistance efflux transporter EmrE 0.01
Further Details:      
 
Domain Number 2 Region: 42-140
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000112
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|158421496|ref|YP_001527723.1|
Sequence length 305
Comment DMT family permease [Deinococcus geothermalis DSM 11300]
Sequence
MLNRPLLAELSLVLIALLWGTSFLVNQHLLGTLSPAALGTERFAVAAFTLLLLQLGTRQA
PGTLKRVLLPGALIGLFNGAAYLTLNAGLVGTTAGKAAFLVGGSAVLVPLFGWLLFRHRI
TALTAACVATATLGLLLLSGATNLTLGAPEATLLLSAALFAVQVLLGGHYARSLPPLPLL
TAQLTVAALVSLAVTALRGESLHLVTLVSTPSLLGSLFILAVPATAIAYVWQLRAQQVIS
PTRVVMIFLLEPVFAALSDYLFLGNLLRHSQLLGAVLILAGLILMEVLPRLRVRLPLSPL
PQSTD
Download sequence
Identical sequences A8ZRB6
gi|158421496|ref|YP_001527723.1|NC_009939 319795.Dgeo_2982 WP_012173357.1.71355 gi|158421496|ref|YP_001527723.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]