SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158421599|ref|YP_001527826.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|158421599|ref|YP_001527826.1|
Domain Number - Region: 103-190
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00023
Family Single strand DNA-binding domain, SSB 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|158421599|ref|YP_001527826.1|
Sequence length 200
Comment ssDNA-binding protein [Deinococcus geothermalis DSM 11300]
Sequence
MPARFTLLGALHSAPRGRTFTLAGTEVINQRGTVREVRFYHVLTAAKLEALHGLTVGLPY
FAEGEVRPLSESNGKVTLQVDELTALSPIPTERDRRAGYVLTRGINQVIAAGHLATDVSP
QVLPGTDHILVVNVSLRVFPDAGLLETSSYGRAAQALTGGRKGDAAVLIGRLNNEKRTDS
QGQQRVYTRLESYRPSVGEI
Download sequence
Identical sequences A8ZRL9
319795.Dgeo_3087 gi|158421599|ref|YP_001527826.1| gi|158421599|ref|YP_001527826.1|NC_009939 WP_012173260.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]