SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94971829|ref|YP_593869.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94971829|ref|YP_593869.1|
Domain Number 1 Region: 304-505
Classification Level Classification E-value
Superfamily Precorrin-8X methylmutase CbiC/CobH 2.35e-64
Family Precorrin-8X methylmutase CbiC/CobH 0.0000498
Further Details:      
 
Domain Number 2 Region: 4-250
Classification Level Classification E-value
Superfamily Chelatase 8.29e-52
Family Ferrochelatase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94971829|ref|YP_593869.1|
Sequence length 520
Comment precorrin-8X methylmutase CbiC/CobH [Deinococcus geothermalis DSM 11300]
Sequence
MSGYAILLAAHGSRDPASAAQFGELVAQVKALEPGRLITHGFLEFNTPTIAQAAQAAIAA
GAREIVLVPGVLLAATHAKNDLPSELNALRRAFPQVTFHCGAALDLHPALLEVCRERLLE
AEVAAGREVRRDETLLLLVGRGTTDPDANGDVHKLARFLEEGLGYGASLVCYSGTAKPDL
PTGLARAARLGFARVVVLPYLLFDGVLVRRVREAVAAAAQRWPDTEFLSAGHLGPHPKVA
QVFLERAQEGVRGQGHMNCSLCKYRVAVVGYEAQVGQPQVGHHGAVRGLLAGGTVPERQG
IPPYEPHPIERQSFEIIESLRDWSAVPPADRSVMQRLVHTAGTPEIVDDLYFSPGAVEAG
VTAILRGLTVVTDVTMVQSGLKREVLRTLGVPVWCGVHDPETHLLSRETGLTRSAAGIRR
AFEKFGNDCIVAIGDAPTAIFEAVRLIEERHWRPGLVIGLPVGFVGTRESKAALRACLRV
PRITNAGTRGGSPWASSVVNALMIEAQNRLAAVSAAGAGA
Download sequence
Identical sequences Q1J3Y3
319795.Dgeo_2360 gi|94971829|ref|YP_593869.1|NC_008010 WP_011525692.1.71355 gi|94971829|ref|YP_593869.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]