SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94971903|ref|YP_593943.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94971903|ref|YP_593943.1|
Domain Number 1 Region: 287-356
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 0.0000000000248
Family Hypothetical protein PA1324 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94971903|ref|YP_593943.1|
Sequence length 689
Comment hypothetical protein Dgeo_2435 [Deinococcus geothermalis DSM 11300]
Sequence
MRKIPLTLCLLGTAAAQQFSNTATLHSFLPTGEEQILPSNAVQLQRGPVCAPTVVRDELG
ELILNVPGTLFVPYTITQGEVGGTVGLQAEVSAEPGWSSRVAIFEDTNRDGRPDGPALTQ
LNLNPGEQHRVLLAIGADTAPPSPVQIRLIATCGVRQTTTDPVLVRVQPALVTLPLEHVA
GLAQATIGDIVPFTVTLRNPLDVPLKILVDVTLPDFARYVPRADDGAPAVQGHTLRWTVD
VPAGGRQSLTYRVAVTAAPSSQLTSVAQARAEYEGAVLSSPSVQASVKLQAGVFDSRGTL
IGRVFVDQNGNGQYDAPDLPTAGVRVVLPNGLQTLTDPQGNYTFRQLAPGPWLVALDPAT
LPSEPADGNLRRSTDVQGLARMDFALQPTTRSAAPPPSTPAAGLQTASSQGFIRFPLPNT
VVRGSSQTRVVLEGPSGVPARLRVNGREVPASLLGEQGPGETPGSVRLTYIGVPLQSGQN
LLEAQFGDRQEQLPITLAGTPQRLVFRPISVVADGHTPLEVEIAALDAQGQASGQGFVTV
QTDLEPTLPDAAPLESGYQLALRDGVARLVLAPLPVGREWTLKAALGNLTAETRLYATTG
GQTLALGQGSVGVTFGQDGLAVHGLARGYLEAPLAGGHVRAALDTQGFPAEEDFRLFPVT
GSSTEAQLPLRSEDGFAVRYDRADLSAGW
Download sequence
Identical sequences Q1J3R5
WP_011525621.1.71355 gi|94971903|ref|YP_593943.1| gi|94971903|ref|YP_593943.1|NC_008010 319795.Dgeo_2435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]