SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94971909|ref|YP_593949.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94971909|ref|YP_593949.1|
Domain Number 1 Region: 177-254
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 0.00000000196
Family Hypothetical protein PA1324 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94971909|ref|YP_593949.1|
Sequence length 643
Comment hypothetical protein Dgeo_2441 [Deinococcus geothermalis DSM 11300]
Sequence
MGDIADNVFFNRSHVLTSTDVTHKTATTVRVRLRVVVLVPIADVTIDLGVQLRAVASGNP
ELMTQTYTAPFPQTRTFSSSTVTVGTLVTSLLNQLQVSLTPNQTQVTLLGALPLPIPLDS
IVNPLLTGLVSPIASQLSALLSPVLTTVLGGLVDPLLQLLGIQLGQATFSVMGISSLCPI
SGTVYRDLQPDGVRNNGENWSTGPNVYVNLVQNNQVLQSLLVTPGSGAYTFNDVPPGTFT
LLVTTAAGAVTPIPPAGWLFVEPNPGLRTVTVLSTPLLNQDFGLFAGTRLQGLVFLDQGQ
SGGIPNDARQNGQEPPVAGVSLRLNNAIQTVTATTGTDGRYTLYWPAEWGNTGTLTVLGR
PVTGVSDGTTVTQTADLAGSNVNGLPLDVTPGQDLIRSFGVVEFSAFTADASGRSGAPGR
VRYTHFYRPGTLGTVNLSANGTAGVTYRFARDLNCNGVVEDAERTSITSFVVDQSWPREP
DGRLRSCALEVEVQIPAGQPNGSIDTATLTATLSWSGSPVQDPRSLTDTTSITPQATLTK
KLRNLTRNSEITESQVEAYPNETLEYCLEYQNLSGQTLNQLVLNDTLPTPLVYLPGTLRR
DGLPLTDAADSDDGEVNDRQLTIRLASLAAGATGNVCFQVRVP
Download sequence
Identical sequences Q1J3Q9
319795.Dgeo_2441 WP_011525615.1.71355 gi|94971909|ref|YP_593949.1|NC_008010 gi|94971909|ref|YP_593949.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]