SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94971951|ref|YP_593991.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94971951|ref|YP_593991.1|
Domain Number 1 Region: 285-576
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.63e-64
Family beta-glycanases 0.0021
Further Details:      
 
Domain Number 2 Region: 2-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.41e-46
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0048
Further Details:      
 
Domain Number 3 Region: 187-283
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000147
Family beta-Galactosidase/glucuronidase domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94971951|ref|YP_593991.1|
Sequence length 623
Comment glycoside hydrolase family protein [Deinococcus geothermalis DSM 11300]
Sequence
MPLSTHPTPLLERDHWRSLDGLWRFCFDDEARWQHPREVVFDREIRVPYAPESLSSGVHD
QGFHSTVWYSLTVTLTPEERSERLLLHFGAVDYLATVWVNGRLVAQHEGGSTPFTADITQ
QAQAGETVELVVRAQDNPHDLAKPRGKQDWQREPHSIWYPRTTGIWQTVWLERVPQTYLR
KLRWLGDMEHWQIGLEAEVVGPLPPDLGLRVRLWCNGDLLADDRYAVRTTEIARRIALAD
PGIDDFRNELLWSPGHPQLIDAELELLVGDRVIDRVRSYTALRSVSVNGNRFLLNGRPYY
LRLVLDQGYWPDSLMTATDEELRRDVELAKRLGFNGVRKHQKIESPRWLYWCDVLGLLVW
EEMPSAYRFTPAAVGRLTREWLEVLERDISHPCIVTWVPLNESWGVPDLPTNPAHRDYVR
ALYFLTKTLDPSRPVVGNDGWEHVATDIVTIHDYADDIELLRRRYGTLEATRLTLQQQQP
ADRALTLAGFEVAGQPVVLSEFGGIAYIPGQELGWGYSESQSEEDFVKDYGALLSAIHEC
HGLSGFCYTQLTDTFQEKNGLLYADRTPKADIQKLARSTQGTRTAREMTVDPILNPFGNS
ARWLRRQQETLMFIEMNLDVDRE
Download sequence
Identical sequences Q1J3L7
WP_011526078.1.71355 gi|94971951|ref|YP_593991.1| gi|94971951|ref|YP_593991.1|NC_008010 319795.Dgeo_2483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]