SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94971975|ref|YP_594015.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94971975|ref|YP_594015.1|
Domain Number 1 Region: 14-255
Classification Level Classification E-value
Superfamily SIS domain 2.83e-62
Family mono-SIS domain 0.0000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94971975|ref|YP_594015.1|
Sequence length 305
Comment N-acetylmuramic acid 6-phosphate etherase [Deinococcus geothermalis DSM 11300]
Sequence
MTTPPSSPLSDPRRTEGVHPTHTDLDRLDPLALVQVFTDDQRAAVEAVRAAVPALARAVE
AALPRLERGGRLVYVGAGTSGRLAVLDATELTPTFSWPPERAVPLIAGGERAIRQAVEGA
EDDAEAGAADVRAAGTGPQDVLIALAASGTTPYVLGAVRAARALGALTIGLANNPGTPLL
AAAECPILLDTGPEVISGSTRLKAGTAQKIALNTLSSALMVRLGKVYGNLMVDVKVSNAK
LETRALRLTCHATGASEAEARAALAQAGGRVKTALVMLRLGLSAPEAEVRLQAAGGHARV
ALGEG
Download sequence
Identical sequences Q1J3J3
gi|94971975|ref|YP_594015.1|NC_008010 gi|94971975|ref|YP_594015.1| 319795.Dgeo_2507 WP_011526055.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]