SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94971986|ref|YP_594026.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94971986|ref|YP_594026.1|
Domain Number 1 Region: 37-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.59e-38
Family Thioltransferase 0.00043
Further Details:      
 
Weak hits

Sequence:  gi|94971986|ref|YP_594026.1|
Domain Number - Region: 4-34
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0689
Family Transcriptional factor domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94971986|ref|YP_594026.1|
Sequence length 141
Comment thioredoxin [Deinococcus geothermalis DSM 11300]
Sequence
MSEVAVCTNCGAKNRLAPPPAGQVPVCGRCGHPLPWLLNVSDATFDTEVKAAVPVLVDFW
ATWCGPCRVVAPVLEDLAREHAGKLKVVKLDVDQNPAVAGRYSVRSIPTLMLFQEGRPLE
TWVGAIPKGSLEARLAPYLRG
Download sequence
Identical sequences Q1J3I2
gi|94971986|ref|YP_594026.1|NC_008010 319795.Dgeo_2518 gi|94971986|ref|YP_594026.1| WP_011526044.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]