SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94972051|ref|YP_594091.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94972051|ref|YP_594091.1|
Domain Number 1 Region: 3-74
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.61e-17
Family ArsC-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94972051|ref|YP_594091.1|
Sequence length 84
Comment glutaredoxin [Deinococcus geothermalis DSM 11300]
Sequence
MSMTVTVYTVPNCSSCEAVKRFLRSRGVPFTEKNIREDPAALAEMQARANVRIAPVTVIG
DQAFYGTFDDQRPLLEAALGENGI
Download sequence
Identical sequences A0A246BJG2 Q1J3B7
WP_011525981.1.12071 WP_011525981.1.71355 WP_011525981.1.89019 2005194610 gi|94972051|ref|YP_594091.1|NC_008010 319795.Dgeo_2583 gi|94972051|ref|YP_594091.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]