SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94972071|ref|YP_594111.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94972071|ref|YP_594111.1|
Domain Number 1 Region: 177-353
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 9.52e-58
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.00014
Further Details:      
 
Domain Number 2 Region: 360-461
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 3.4e-32
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.00028
Further Details:      
 
Domain Number 3 Region: 94-199
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 9.55e-27
Family CO dehydrogenase ISP C-domain like 0.00032
Further Details:      
 
Domain Number 4 Region: 2-88
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.49e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94972071|ref|YP_594111.1|
Sequence length 468
Comment molybdopterin dehydrogenase [Deinococcus geothermalis DSM 11300]
Sequence
MDSITLTVNGVPREARDVRPHLTLLNWLREQGLTGCKEGCAEGECGACAVLLARPTEDGG
TRLDAVNACLVLLAALNGQEVITAEGLGAPGTLHPVQRELAYRGGSQCGYCTPGFVVSMA
AEYYREDRPAGDFDLHALSGNLCRCTGYRPIADAAQALGGVAEGDPFAQRCTEPAPPPQA
THLTTPDGEFHRPTTLAQALDLLAATPGAVLLAGGTDWGVEVNLRHRRAPVTIAIDRLSE
LQTLSWQDDHVEIGAGLSLSEVERRLAGRIPLLEELFPLFASRLIRNSATLGGNLGTASP
IGDSPPVLLALDARVVLASREGEREVPLADYFTGYRQTLRRPGELIRAVRIPLPLAPITG
FYKIAKRRFDDISSVAVAVALDLDGDVVRSIRIGLGGVAATPLRARAAEEALTGQPWNER
TVRAAARLLRGEGTPLDDHRASAAYRAAMLEGALLKFYFEKTAQEVTP
Download sequence
Identical sequences Q1J397
WP_011525963.1.71355 319795.Dgeo_2603 gi|94972071|ref|YP_594111.1| gi|94972071|ref|YP_594111.1|NC_008010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]