SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94972083|ref|YP_594123.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94972083|ref|YP_594123.1|
Domain Number 1 Region: 9-421
Classification Level Classification E-value
Superfamily GckA/TtuD-like 6.15e-124
Family GckA/TtuD-like 0.00000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94972083|ref|YP_594123.1|
Sequence length 422
Comment hydroxypyruvate reductase [Deinococcus geothermalis DSM 11300]
Sequence
MSAPGKAVDVRALLEQSYRSALEAVAPARLLAPHLTGLRPDFVLAFGKAALPMLRAALEA
YPSVPGLAVPPRGTPDLSAPQGAEVLPGSHPVPDEHSVYAAEQALLRVRALPEGSQLLVL
VSGGGSALLSAPWGVTLVQKQALTRELLRAGAAIEEINAVRKHLSRVKGGRLAQATRARV
RALLISDVIGDDPSVIASGPTVPDPTTFADALAVLDRYGVAAPEARAHLEAGARGELAET
PKPGELPHVENVIIGSNRVLLEAAQAFLTAQGVRSVILADTFGGEARDLAGFHASLVGSI
RDHGTPFQGPLVLLSGGEATVTVRGAGRGGRNQEFALWLLEDLGERGVYALSAGSDGIDG
HSDAAGAFLTPDSLVRARALGLDPRAFLARNDSGTFFAALGDALITGPSGHNLNDYRAIY
VM
Download sequence
Identical sequences Q1J385
319795.Dgeo_2615 gi|94972083|ref|YP_594123.1| gi|94972083|ref|YP_594123.1|NC_008010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]