SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94972111|ref|YP_594151.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94972111|ref|YP_594151.1|
Domain Number 1 Region: 74-214
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.17e-46
Family NPCBM-like 0.00027
Further Details:      
 
Domain Number 2 Region: 228-569
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000377
Family Pectate transeliminase 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94972111|ref|YP_594151.1|
Sequence length 601
Comment glycosyl hydrolase family protein [Deinococcus geothermalis DSM 11300]
Sequence
MMNKVPAARVVLSSVGLLGLTLALSACGSSTPAAQTSTAEAAPTFNYDGQDHSWSSSDAQ
GVLQPLTISQGDNTLSYENWTSATNGWGPIERNRSNGEKNAGDGRTLTIGGQTYATGFGV
HAGSSMTFSLAGQCQTFTAQVGIDDEVGNRGSVVFQVFADGTKVYDSGVLRGTDAPKTLS
VSVAGKQELRLVVTDAGDGISYDHADWANPKLLNCTPTSSTVPAPTPAPGEVTYSGPITI
TKGGTYSGNWESTTTSPAVLIKTSDPVIIENANIRGRGDLISGFRYRLTVRNVRGYGLNP
NVAGKTVGKAVNAEENYSLRIENSYFENTRGIYVRQFFGDPNKGETIKILRNKFRNINGL
KSDGAGGYTTESDIVQFLLFNNVTRIQNAEIAWNEVINEPFKSRTEENINMFKSSGTPNS
PILIHDNYIQGAYPINPDTTTSYPGGGILLGDGKVTDPLDLGYTRVYNNQIVSTTNHGLA
IAGGTDNQVYNNRVISSGRLPDGRRIPAANVGLYVWDAAGGAAQVPSTFNKNVMRDNVVG
WTRVSATGTTSNSVSWFPNCTTNGTVCTGNQNIGTVTLEIERQEYQRWLDKLASAGVKVG
P
Download sequence
Identical sequences Q1J357
319795.Dgeo_2644 WP_011525925.1.71355 gi|94972111|ref|YP_594151.1| gi|94972111|ref|YP_594151.1|NC_008010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]