SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94972116|ref|YP_594156.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94972116|ref|YP_594156.1|
Domain Number 1 Region: 8-199
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.8e-51
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 325-439
Classification Level Classification E-value
Superfamily UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 1.18e-33
Family UDP-glucose/GDP-mannose dehydrogenase C-terminal domain 0.0042
Further Details:      
 
Domain Number 3 Region: 223-320
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.55e-30
Family UDP-glucose/GDP-mannose dehydrogenase dimerisation domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94972116|ref|YP_594156.1|
Sequence length 467
Comment UDP-glucose 6-dehydrogenase [Deinococcus geothermalis DSM 11300]
Sequence
MREDKALRVAVVGTGYVGLGTAVMLAYLGHNVVGVDVDQAKVDLLQRGQLPIYEPHLDQL
LRDSASRLRWTTDYASAIPDADVIFICVGTPPLPNGQPNLSYVAEAAQSIARHLNGKLQV
VVNKSTVPIGTGDWVARLLEDHARDYHAGRYLVVSNPEFLREGTALHDSLYPDRIVLGSD
SPVAIAQLVRLYEPLLDQDFEAPAFVPRPAGYTRPELVTTSLSSAEMIKYAANAFLALKI
SFANEIAGLCEWVDADIQEVTRGIGCDQRIGPRFLGAGAGWGGSCFGKDTAALISIGREY
GYSMPILTAAVEINQRQRQLVITKLQQHLHRLKGKRVAVLGMAFKPNTDDLRDAPAHDCI
QRLVELGAQVVAHDPVAMPRARQEWQHLGYLEAASAEAALHGADAALVMTEWDEYRQLDW
ESALRQMRRRLVIDTRHVITNFSGQGVVEQIGRGRSGTGSLAHEVAI
Download sequence
Identical sequences Q1J352
319795.Dgeo_2649 gi|94972116|ref|YP_594156.1|NC_008010 WP_011525920.1.71355 gi|94972116|ref|YP_594156.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]