SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94972132|ref|YP_594172.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94972132|ref|YP_594172.1|
Domain Number 1 Region: 236-381
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-48
Family NPCBM-like 0.0002
Further Details:      
 
Domain Number 2 Region: 452-678
Classification Level Classification E-value
Superfamily Kelch motif 2.49e-44
Family Kelch motif 0.0016
Further Details:      
 
Domain Number 3 Region: 79-229
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.89e-36
Family NPCBM-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94972132|ref|YP_594172.1|
Sequence length 693
Comment glycosyl hydrolase family protein [Deinococcus geothermalis DSM 11300]
Sequence
MKSPVRLISSAMLLLGTLLGLGACTDGGTPAASDPYAGGVSYPWTDQTPTPADPYASGIS
YPWTGPSAASLQPAGLSGDNSLSDLSWTPGSAANAWGPIELNRSNGEKNAGDGRTLTIGG
QSFPKGLGMHANGEVSYATGGSCSTFTATVGIDDEVGDRGSVVFEVWDGTTTRLYATPIL
RGSDPPFNLTVPLTRPDGSAVRDLRLVVRDAGDGISYDHADWANPTLSCSATPPSGDVFV
SDLDWNTPSNGWGPIEQDLSNGEKGLADGRTLTIGGQSFPKGLGMHANGSVTYLLGGRCS
TFTASVGVDDEVGDRGSVVFQVFGDGTKLYDSGVRRGTDGPQALNVNVSGVQQLKLVVTD
AGDSISYDHADWANAKLSCSSDTNTLTYTPIADQPYVVAEAMGQVVRGKLYTFGGFDSLK
SGFTPTDRAYVYDPDANTWTPIARMPNRGATHAGMTTDGTDIFYAGGYVADANWTGQVFG
SKEVWRYNVASNTYTRLPDLPVARAAGGLEYLNGKLHYFGGTNLSRQDVGDHFVLDLAGG
ATSWTTAAPLPNPRNHLGAAVLGGKIYAVGGARGQDQNSVQQTAVHAYDPATNTWTAVAS
LPRGLSHNADTTFVLGGRIIVAGGEVAYNVSTRDVTAYNPATNTWTPLTPLPIGREASVA
DALGNGFLYTGGNQPGWVKSGWRAMPQAASSQP
Download sequence
Identical sequences Q1J336
gi|94972132|ref|YP_594172.1|NC_008010 WP_011525905.1.71355 319795.Dgeo_2665 gi|94972132|ref|YP_594172.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]