SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94972133|ref|YP_594173.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94972133|ref|YP_594173.1|
Domain Number 1 Region: 238-383
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.62e-47
Family NPCBM-like 0.0002
Further Details:      
 
Domain Number 2 Region: 81-231
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.1e-36
Family NPCBM-like 0.00065
Further Details:      
 
Domain Number 3 Region: 384-475
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000226
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 4 Region: 853-969
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000281
Family YxiM N-terminal domain-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94972133|ref|YP_594173.1|
Sequence length 970
Comment glycosyl hydrolase family protein [Deinococcus geothermalis DSM 11300]
Sequence
MKKTTPWQSRATLLLALSLSLAACSQAPSPETSANDPYAGGVSYPWTDQTPTPADPYASG
ISYPWTGPSAASLQPAGLSGDNSLSDLSWTPGSAANAWGPIELNRSNGEKNAGDGRTLTI
GGQSFPKGLGMHANGEVSYATGGSCSTFTATVGIDDEVGDRGSVVFEVWDGTTTRLYATP
ILRGSDPPFNLTVPLTRPDGSAVRDLRLVVRDAGDGISYDHADWANPTLSCSATPPSGDV
FVSDLDWNTPSNGWGPIEQDLSNGEKGLADGRTLTIGGQSFPKGLGMHANGSVTYLLGGR
CSTFTASVGVDDEVGDRGSVVFQVFGDGTKLYDSGVRRGTDGPQALNVNVSGVQQLKLVV
TDAGDSISYDHADWANAKLSCSSDTTPPATPSGLTATGTPDGITLDWSDNSEADLAGYKV
YGSASPNGPFQLLTPQPIQQSAWTDTSVPPGATEYYQVVAVDSSGNASAPASVSATRLSG
STAAKIEIENLDGTPWNDRLVFSRIGSLASPPSNGVHNLVTLRVKNTGAATLRISSLPIQ
DTWTLDPAITLPLDIPPGGSADLRLRFVAETTKAHFGTLTINSNDPATPSLAVQLAGLWQ
SQSENNQEPSTLQIRDAFGFKNSLLGGEASLNQKGLVRAQGDEVLSPYWQRADETQPVVV
RQLAAYHTQGNTATLNWHAKGSNTLNTVFTHAGIDGQTVLPRLNGSSTQLAYKAFTPTAK
TFGFNVDSSEWSDPTKNRQGPDLTAGCSGPCGQHIRFYTVRDRAGVLIPNTYFVIMDYSG
INYDYNDNIYLISNIKPAPILINVGGPAFTDPDGNVWTADKYSYTDQNGAQRTYTYYTPS
NAISQPSSPTSVDILNTTNDVLYRTYRHNTLDTPLDSRVMIFDIPVNNGTYQVKLHFAEL
YWNEPGKRLFDVSVEGVPKLTNFDIWAQAGGKNTALVVPINNVQVADGRLTIQLKARVDF
PDLSGIEVTR
Download sequence
Identical sequences Q1J335
WP_011525904.1.71355 319795.Dgeo_2666 gi|94972133|ref|YP_594173.1|NC_008010 gi|94972133|ref|YP_594173.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]