SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94972137|ref|YP_594177.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94972137|ref|YP_594177.1|
Domain Number 1 Region: 64-202
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-42
Family NPCBM-like 0.0002
Further Details:      
 
Domain Number 2 Region: 511-751
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.44e-41
Family Galactose oxidase, central domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94972137|ref|YP_594177.1|
Sequence length 812
Comment glycosyl hydrolase family protein [Deinococcus geothermalis DSM 11300]
Sequence
MKDARAFVGTWCLAGRVAAALLLVGCAQTASQRTQEDFVYDGSDYRWRSDVEPGTLSIDP
GDNTLSFEPWISATSGFGPIERDRSNGEKQGGDGHPLTLGGQTFARGFGVHADSDMTFSL
AGRCQAFSALVGVDDEVGERGSVVFQVFADGTKVYDSGVQRGSDGPQALNVDVTGKDELR
LVVTDAGDGLFYDHADWAQPMLHGCTAASPVPGDRTLAVGPTELIYSGVVGRTSTPQTMT
VRNTGGGPLRIDKITLGGEDAQAFRLVNQPAWPLTLQPGERLEVPVVFAPGRVGVQQAQV
RVESGAAPREVKLYGLSARGEEGDLEPPLQQVVQTLGYTINVGSSGLILGTRPTPIGDEV
LAPLFQKAGPGPVTLRPVARYSPNAAVPFGYYTPGVAGPTLHQVAVLAPGAYQTLNPPIQ
PGGAGSFEPGDASFGLYTGSTSYAQHNSYTQDALNTATITHAARIYPLRDRAGQPLPNSF
LVAFEPALNGDYQDYVFVIGNVKPAPVPAGTTITWRTAANSPLEVYEAQGADVDGRLYVF
GGFFNGLHATARAYAYDPATDRWSAVASMPEPLTHGAVAVDGQTVYVAGGFVGDHPGPQT
NHVWKYDTVRNTWSPAPSLPGARGGGALVRVGRELHFFGGTEREPGNTQLYRRDSADHWV
LNLDGGRSWTSAAPLPNPRNHMAGVALGGRIYAIGGQHLGDEQNGNQRSVEMYDPATDTW
TPRADLPRPLGHTSASTVVWNGRIVVVGGVTQRSAEVANIVEYDPDTNAWTELTPLPAPR
QSPVAGIINNRLVVTTGWQPDSARTTTWIGTR
Download sequence
Identical sequences Q1J331
WP_011525900.1.71355 gi|94972137|ref|YP_594177.1| 319795.Dgeo_2670 gi|94972137|ref|YP_594177.1|NC_008010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]