SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94972148|ref|YP_594188.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94972148|ref|YP_594188.1|
Domain Number 1 Region: 3-261
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 4.48e-49
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.0019
Further Details:      
 
Domain Number 2 Region: 357-459
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.15e-27
Family Single-domain sulfurtransferase 0.06
Further Details:      
 
Domain Number 3 Region: 238-352
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.00000000000314
Family Multidomain sulfurtransferase (rhodanese) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94972148|ref|YP_594188.1|
Sequence length 464
Comment beta-lactamase-like protein [Deinococcus geothermalis DSM 11300]
Sequence
MFFKRFYDTDLAQASYMIGCQQTGECLVVDPIRDIQQYLDEAKSQKLRVTHVTETHIHAD
YLSGSRELAKATGAKLLLSDEGGEGWRYTYDDGNQIRLHDGDTFMVGNVRIDVLHTPGHT
PEHLSFLVTDTPRGDTPSMILTGDFVFVGDLGRPDLLDEAAGGQDTRFVGAKQMFASLRD
KFLSLPDYVQVWPGHGAGSACGKALGAVPTTTVGYERALSWWGKLVEKGDEEAFTQELLS
GQPDAPLYYGRMKRENRDGPALLGEVQALPELSVKDVQAWLAAGARLIDTRRKEEHQAAA
PVGSINIPDGNTFETWAGWLLKPERAFILLAPAHRAEVLRRRLWMVGLDNVIGFIPSAEG
LETAPAQPIPASELPQHEDALILDVRAKTEYERGHIPGAHQLHAGRLPWRLSTLPRDREI
VVHCQGGARSAAAASLLRAEGFQVTELAGGYDAWAKTQQETLPA
Download sequence
Identical sequences Q1J320
gi|94972148|ref|YP_594188.1|NC_008010 319795.Dgeo_2681 gi|94972148|ref|YP_594188.1| WP_011525889.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]