SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94972222|ref|YP_594262.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|94972222|ref|YP_594262.1|
Domain Number - Region: 136-207
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000152
Family Thioredoxin-like 2Fe-2S ferredoxin 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|94972222|ref|YP_594262.1|
Sequence length 299
Comment sucraseferredoxin-like [Deinococcus geothermalis DSM 11300]
Sequence
MKVPLCADVSRAQGEDPIGTAPHWAEVTVLELDVRVWAQLRRVEAWTSEERQVFERLRGK
VEASGAGFGLLMSAPEQVGAPLRVRHYTQGPGGYTRRDYRSSLPQSAWAQALTDTLLEPQ
RLRDWEELPAPDGPDLHVCTHGTVDAACGRYGFPVYRALHEAGLRAWRTGHFGGHRFAAT
AVEFPSGLLWAHLTPDLALRVARRDLHPAEVKPHLRGFAGLPPLAQVLDRELLVQHGWAW
LEAERAATVNASEVLLAYRWKGQQGEVRARVEEAGRLTVTESSHTGEPLEVKQYRVVFL
Download sequence
Identical sequences Q1J2U6
gi|94972222|ref|YP_594262.1| 319795.Dgeo_2755 WP_011525817.1.71355 gi|94972222|ref|YP_594262.1|NC_008010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]