SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94972249|ref|YP_594289.1| from Deinococcus geothermalis DSM 11300

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94972249|ref|YP_594289.1|
Domain Number 1 Region: 460-889
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.89e-45
Family Glycosyltransferase family 36 C-terminal domain 0.032
Further Details:      
 
Weak hits

Sequence:  gi|94972249|ref|YP_594289.1|
Domain Number - Region: 162-237
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0191
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94972249|ref|YP_594289.1|
Sequence length 941
Comment alpha-L-rhamnosidase [Deinococcus geothermalis DSM 11300]
Sequence
MTVTPTALLCESLREPLGLDTRQPRLSWVLKADRRRVRQTAYELLVAATEADLTPENALW
STGRVPSRQSVYVRYEGPPLASRGRYFWRVRVWDETGGVSNWSAPSFWEMGLLNPEDWQA
RWVEPQQEPVTPEPSINFFAAMEVKPRTLDETRTLPEKLHACPRLRRTFEVPGLVRRARL
YATAHGLYTLELNGRQVGDRELTPENTSYPQYLMYQTYDVTGQVQVGQNALGVTLADGWY
AGRTSAAGDSLNFGDRLAVLFQLEIELEDGTRVTVISDENMRSSVGGPLVYSDLFIGERC
DARREMPGWSAPGFDDSGWNPVTLADHGYGNLVAQYGEPVRAVQALPAVQVLTTPAGETV
VDFGQVIAGRMRMTVRGPTGTEVFLQHGEVLDEHGNFFQNISWRNKDQTDVYVLRGGGEE
TYEPTFTFHGFRYVKVTGYPGEVRPEDFTAVVLASDLPPAGTFETSDPRLNRLQANIVWS
QRGNFLSIPTDCPQRERTGWTGDIQAFAPTAVFNMGVKAFLTRWLRNVQREQLPDGQIPN
FVPTTPSMADPFNAPSSAGWGDACIIVPWVLYREYADEGVLAESYPTMQRWLAYIERQAA
NGLPEGMTPEQLTPAERERQRYLWNTGFHFGDWLIPSIPNPVEGALATRELVATCFYAYS
AGLLARVARVLGKTEDAERYAELNRRVRRAFTEEYLSADGRLKAHFQGIYVLALHLGMIP
EESRPGVLGQLLGLIEANGDRLDTGFASVPFLLDVLCDHGRADVAYRLLFQTECPSWLYE
VERGATTIWETWRAITPDGKVQPVSYNHYAFGCVGDWMYRRLGGLWRLEPGYRHFAVRPD
FGCGLTWVRTRHETVYGTAAVFWTRKSDGLTLEVTVPAGTTATVHLPGPAGNVRLDGAPL
ELGEGVSGVATRDDEVQVTIGSGTYTFTATLMGPRKVDLTM
Download sequence
Identical sequences Q1J2R9
WP_011525790.1.71355 gi|94972249|ref|YP_594289.1| gi|94972249|ref|YP_594289.1|NC_008010 319795.Dgeo_2783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]